专利摘要:
The present disclosure relates to compositions and methods useful for the production of heterologous proteins in filamentous fungal cells, in particular in a filamentous fungal cell comprising at least three endogenous proteases having reduced activity, and a recombinant polynucleotide encoding a heterologous polypeptide, wherein the polypeptide is produced at a level of at least two-fold higher than the production level of the polypeptide in a corresponding parental filamentous fungal cell in which the proteases do not have the reduced activity.
公开号:AU2013207165A1
申请号:U2013207165
申请日:2013-01-04
公开日:2014-07-03
发明作者:Anna-Liisa Hanninen;Anne Huuskonen;Anne Kanerva;Christopher Landowski;Jari Natunen;Merja Penttila;Juhani Saarinen;Markku Saloheimo;Noora Salovuori;Ann Westerholm-Parvinen
申请人:Novartis AG;Glykos Finland Ltd;
IPC主号:C12N1-15
专利说明:
WO 2013/102674 PCT/EP2013/050126 PROTEASE DEFICIENT FILAMENTOUS FUNGAL CELLS AND METHODS OF USE THEREOF FIELD OF THE INVENTION [0001] The present disclosure relates to compositions and methods useful for the production of heterologous proteins in filamentous fungal cells. BACKGROUND [0002] Posttranslational modification of eukaryotic proteins, particularly therapeutic proteins such as immunoglobulins, is often necessary for proper protein folding and function. Because standard prokaryotic expression systems lack the proper machinery necessary for such modifications, alternative expression systems have to be used in production of these therapeutic proteins. Even where eukaryotic proteins do not have posttranslational modifications, prokaryotic expression systems often lack necessary chaperone proteins required for proper folding. Yeast and fungi are attractive options for expressing proteins as they can be easily grown at a large scale in simple media, which allows low production costs, and yeast and fungi have posttranslational machinery and chaperones that perform similar functions as found in mammalian cells. Moreover, tools are available to manipulate the relatively simple genetic makeup of yeast and fungal cells as well as more complex eukaryotic cells such as mammalian or insect cells (De Pourcq et al., Appl Microbiol Biotechnol, 87(5):1617-3 1). Despite these advantages, many therapeutic proteins are still being produced in mammalian cells, which produce therapeutic proteins with posttranslational modifications most resembling the native human proteins, whereas the posttranslational modifications naturally produced by yeast and fungi often differ from that found in mammalian cells. [0003] To address this deficiency, new strains of yeast and fungi are being developed that produce posttranslational modifications that more closely resemble those found in native human proteins. Thus, there has been renewed interest in using yeast and fungal cells to express more complex proteins. However, due to the industry's focus on mammalian cell culture technology for such a long time, the fungal cell expression systems such as Trichoderma are not as well 1 WO 2013/102674 PCT/EP2013/050126 established as mammalian cell culture and therefore suffer from drawbacks when expressing mammalian proteins. [0004] Thus, a need remains in the art for improved filamentous fungal cells, such as Trichoderma fungus cells, that can stably produce heterologous proteins, such as immunoglobulins, preferably at high levels of expression. SUMMARY [0005] Described herein are compositions including filamentous fungal cells, such as Trichoderma fungal cells having reduced or no detectable activity of at least three proteases, and having a recombinant polynucleotide encoding a heterologous polypeptide that is produced at increased levels. Further described herein are methods of improving heterologous polypeptide stability and methods of making heterologous polypeptides in which the proteases do not have the reduced activity. [0006] Thus one aspect includes filamentous fungal cells having reduced or no detectable activity of at least three proteases, where the cell further contains a recombinant polynucleotide encoding a heterologous polypeptide produced at a level of at least 2-fold higher than the production level of the polypeptide in a corresponding parental filamentous fungal cell in which the proteases do not have the reduced activity. In certain embodiments, when the cell is an Aspergillus cell, the total protease activity is reduced to 50% or less of the total protease activity of the corresponding parental Aspergillus cell in which the protease do not have reduced activity. In other embodiments, the total protease activity of the filamentous fungal cell is reduced to 49% or less, 31% or less, of the total protease activity of the corresponding parental filamentous fungal cell in which the proteases do not have the reduced activity. [0007] In certain embodiments, the expression level of the at least three proteases is reduced or eliminated. In certain embodiments, genes encoding the three proteases each comprise a mutation that reduces or eliminates the corresponding protease activity. In certain embodiments that may be combined with the preceding embodiments, the three protease encoding genes are 2 WO 2013/102674 PCT/EP2013/050126 pep], tsp], and sip]. In other embodiments, the three protease encoding genes are gap], sip], and pep]. [0008] In certain embodiments, the fungal cells have reduced or no detectable activity of four endogenous proteases; genes encoding the four proteases each comprise a mutation that reduces or eliminates the corresponding protease activity. In certain embodiments that may be combined with the preceding embodiments, the four protease encoding genes are pep], tsp], sip], and gap]. [0009] In certain embodiments that may be combined with the preceding embodiments, the three or four protease encoding genes are selected from pep], pep2, pep3, pep4, pep5, pep8, pep]1, pep12, tspl, sip], sip2, sip3, sip7, gap], and gap2. In certain embodiments that may be combined with the preceding embodiments, the three or four protease encoding genes are selected from pep], pep3, pep4, tsp], sip], sip2, gap], and gap2. In certain embodiments, the three or four protease encoding genes are selected from pep], pep2, pep3, pep4, pep5, gap], gap2, sip], sip2, and tspl. [0010] In other embodiments, the fungal cells have reduced or no detectable activity of five endogenous proteases; genes encoding the five proteases each comprise a mutation that reduces or eliminates the corresponding protease activity. In certain embodiments that may be combined with the preceding embodiments, the five protease encoding genes are pep], tsp], sip], gap], and pep4. In other embodiments, the five protease encoding genes are pep], tsp], sip], gap], and gap2. [0011] In certain embodiments, the fungal cells have reduced or no detectable activity of six endogenous proteases; genes encoding the six proteases each comprise a mutation that reduces or eliminates the corresponding protease activity. In certain embodiments, the cell has six protease encoding genes, each of which comprise a mutation that reduces or eliminates the corresponding protease activity, and the six protease encoding genes are pep], tsp], sip], gap], gap2, and pep4. [0012] In certain embodiments that may be combined with the preceding embodiments, the fungal cells have three to six proteases having reduced or no detectable activity each of the three 3 WO 2013/102674 PCT/EP2013/050126 to six proteases selected from pep], pep2, pep3, pep4, pep5, tspl, sip1, sip2, sip3, gap], and gap2. [0013] In certain embodiments that may be combined with the preceding embodiments, the cell has seven protease encoding genes, each of which comprise a mutation that reduces or eliminates the corresponding protease activity, and the seven protease encoding genes are pep], tspl, sip], gap], gap2, pep4, and pep3. [0014] In certain embodiments that may be combined with the preceding embodiments, the cell has eight protease encoding genes, each of which comprise a mutation that reduces or eliminates the corresponding protease activity, and the eight protease encoding genes are pep], tspl, sip], gap], gap2, pep4, pep3, and pep5. [0015] In certain embodiments that may be combined with the preceding embodiments, the fungal cell has an additional protease having reduced activity, the gene encoding the additional protease comprises a mutation that reduces or eliminates the corresponding protease activity, and the additional protease is selected from pep7, pep8, pep]], pep12, tpp], gap2, sip3, sip5, sip6, sip7, and sip8. [0016] In certain embodiments that may be combined with the preceding embodiments, the heterologous polypeptide is a mammalian polypeptide. In certain embodiments, the mammalian polypeptide is glycosylated. [0017] In certain embodiments, the mammalian polypeptide is selected from an immunoglobulin, an antibody and their antigen-binding fragments, a growth factor, an interferon, a cytokine, and an interleukin. In certain embodiments, the mammalian polypeptide is an immunoglobulin or an antibody. In certain embodiments, the mammalian polypeptide is selected from insulin-like growth factor 1 (IGF1), human growth hormone (hGH), and interferon alpha 2b (IFNa2b). [0018] In certain embodiments that may be combined with the preceding embodiments, the heterologous polypeptide is a non-mammalian polypeptide. In certain embodiments, the non 4 WO 2013/102674 PCT/EP2013/050126 mammalian polypeptide is an aminopeptidase, amylase, carbohydrase, carboxypeptidase, catalase, cellulase, chitinase, cutinase, deoxyribonuclease, esterase, alpha-galactosidase, beta galactosidase, glucoamylase, alpha-glucosidase, beta-glucosidase, invertase, laccase, lipase, mutanase, oxidase, pectinolytic enzyme, peroxidase, phospholipase, phytase, polyphenoloxidase, proteolytic enzyme, ribonuclease, transglutaminase or xylanase. [0019] In certain embodiments that may be combined with the preceding embodiments, the fungal cell further contains reduced or no detectable activity of ALG3, a mannosyltransferase enzyme. In certain embodiments, the gene encoding ALG3 contains a mutation that reduces or eliminates the corresponding activity. In certain embodiments that may be combined with the preceding embodiments, the fungal cell further contains a polynucleotide encoding an a-1,2 mannosidase. [0020] In certain embodiments that may be combined with the preceding embodiments, the fungal cell has a mutation that reduces the expression of a protease desired to have reduced activity. In certain embodiments that may be combined with the preceding embodiments, the mutation is a deletion within the gene encoding the protease. In certain embodiments that may be combined with the preceding embodiments, the mutation is a deletion of the portion of the gene encoding the catalytic domain of the protease. In certain embodiments that may be combined with the preceding embodiments, the fungal cell has a point mutation in the portion of the gene encoding the catalytic domain of the protease. [0021] In other embodiments, the reduction or elimination of protease activity of one or more proteases results from RNAi constructs specific for i) one protease or ii) two or more proteases selected from the group consisting of a pep-type protease, a trypsin-like serine protease, a gap type proteae, a sedolisin protease and a slp-type protease. In certain embodiments, RNAi constructs are specific for sip2, sip3, sip5 and/or sip6. [0022] In certain embodiments that may be combined with the preceding embodiments, the fungal cell further contains an N-acetylglucosaminyltransferase I catalytic domain and an N acetylglucosaminyltransferase II catalytic domain. In certain embodiments, the N 5 WO 2013/102674 PCT/EP2013/050126 acetylglucosaminyltransferase I catalytic domain and the N-acetylglucosaminyltransferase II catalytic domain are encoded by a polynucleotide. In certain embodiments, the N acetylglucosaminyltransferase I catalytic domain is encoded by a first polynucleotide and the N acetylglucosaminyltransferase II catalytic domain is encoded by a second polynucleotide. In certain embodiments that may be combined with the preceding embodiments, the fungal cell further contains a polynucleotide encoding a mannosidase II and/or a galactosyl transferase. In certain embodiments, the fungal cell contains enzymes selected from the group consisting of axl,2 mannosidase, N-acetylglucosaminyltransferase I, N-acetylglucosaminyltransferase II, mannosidase II and/or galactosyltransferase, said enzymes further comprising a targeting peptide, for example a heterologous targeting peptide for proper localization of the corresponding enzyme. In certain embodiments, the targeting peptide is selected from SEQ ID NOs: 589-594. [0023] In certain embodiments that may be combined with the preceding embodiments, the fungal cell is a Trichoderma fungal cell, a Myceliophthora fungal cell, an Aspergillus fungal cell, a Neurospora fungal cell, a Fusarium or Penicilium fungal cell, or a Chrysosporium fungal cell. In certain embodiments that may be combined with the preceding embodiments, the fungal cell is Trichoderma reesei. [0024] In certain embodiments that may be combined with the preceding embodiments, the fungal cell is wild type for pep4 protease. [0025] Another aspect includes methods of improving heterologous polypeptide stability, by: a) providing the filamentous fungal cell of any of the preceding embodiments; and b) culturing the cell such that the heterologous polypeptide is expressed, where the heterologous polypeptide has increased stability compared to the heterologous polypeptide produced in a corresponding parental filamentous fungal cell in which the proteases do not have reduced activity, for example, as not containing the mutations of the genes encoding the proteases. Another aspect includes methods of making a heterologous polypeptide, by: a) providing the filamentous fungal cell of any of the preceding embodiments; b) culturing the host cell such that the heterologous polypeptide is expressed; and c) purifying the heterologous polypeptide. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further 6 WO 2013/102674 PCT/EP2013/050126 contains a carrier protein. In certain embodiments, the carrier protein is CBH1. In certain embodiments that may be combined with the preceding embodiments, the culturing is in a medium comprising a protease inhibitor. In certain embodiments, the culturing is in a medium having one or two protease inhibitors selected from SBT1 and chymostatin. In certain embodiments, the heterologous polypeptide produced according to the method is a glycosylated mammalian polypeptide and at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mole%) of the total N-glycans of the polypeptide consists of Man 3 GlcNAc 2 N-glycan. In other embodiments, the heterologous polypeptide produced according to the method is a glycosylated mammalian polypeptide and at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mole%) of the total N-glycans of the polypeptide consists of complex N-glycan. In certain embodiments, the heterologous polypeptide produced according to the method is a glycosylated mammalian polypeptide and at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mole%) of the total N-glycans of the polypeptide consists of hybrid N-glycan. In certain embodiments, the heterologous polypeptide produced according to the method is a glycosylated mammalian polypeptide and at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mole%) of the total N-glycans of the polypeptide consists of GI or G2 N-glycan. Another aspect includes the heterologous polypeptides obtainable by the methods as described above. [0026] Another aspect includes Trichoderma fungal cells having reduced or no detectable activity of at least three proteases selected frompep1, pep2, pep3, pep4, pep5, tsp], sip1, sip2, gap], and gap2, where the cell further contains a recombinant polynucleotide encoding a mammalian polypeptide produced at a level of at least 2-fold higher than the production level of the polypeptide in a corresponding parental Trichoderma fungal cell. [0027] In certain embodiments, the expression level of the at least three proteases is reduced or eliminated in the Trichoderma fungal cell. In certain embodiments, genes encoding the at least three proteases each comprise a mutation that reduces or eliminates the corresponding protease activity in the Trichoderma fungal cell. In certain embodiments, the Trichoderma fungal cell 7 WO 2013/102674 PCT/EP2013/050126 includes three protease encoding genes with a mutation that reduces or eliminates protease activity, which are selected from gap], sip], and pep]. In certain embodiments that may be combined with the preceding embodiments, the mammalian polypeptide in the Trichoderma fungal cell is an antibody, or their antigen-binding fragments, or an immunoglobulin, and the at least three proteases are selected frompep], pep3, pep4, tsp], sip], sip2, gap], and gap2. In certain embodiments, the Trichoderma fungal cell contains four protease encoding genes, each of which comprise a mutation that reduces or eliminates the corresponding protease activity, and the four protease encoding genes with such mutation are pep], tsp], sip], and gap]. In certain embodiments, the Trichoderma fungal cell has five protease encoding genes, each of which comprise a mutation that reduces or eliminates the corresponding protease activity, and the five protease encoding genes with such mutation are pep], tsp], sip], gap], and pep4. In certain embodiments that may be combined with the preceding embodiments, the mammalian polypeptide in the Trichoderma fungal cell is a growth factor, interferon, cytokine, or interleukin, and the three proteases with reduced activity are selected from pep], pep2, pep3, pep4, pep5, pep8, pep]1, pep12, gap], gap2, sip], sip2, slp7, and tsp]. In certain embodiments, the Trichoderma fungal cell has five protease encoding genes, each of which comprise a mutation that reduces or eliminates the corresponding protease activity, and the five protease encoding genes with such mutation are pep], tsp], sip], gap], and gap2. In certain embodiments, the Trichoderma fungal cell has six protease encoding genes, each of which comprise a mutation that reduces or eliminates the corresponding protease activity, and the six protease encoding genes with such mutation are pep], tsp], sip], gap], gap2, and pep4. In certain embodiments that may be combined with the preceding embodiments, the Trichoderma fungal cell has seven protease encoding genes, each of which comprise a mutation that reduces or eliminates the corresponding protease activity, and the seven protease encoding genes are pep], tsp], sip], gap], gap2, pep4, and pep3. In certain embodiments that may be combined with the preceding embodiments, the Trichoderma fungal cell has eight protease encoding genes, each of which comprise a mutation that reduces the corresponding protease activity, and the eight protease encoding genes with such mutation are pep], tspl, sip], gap], gap2, pep4, pep3, and pep5. 8 WO 2013/102674 PCT/EP2013/050126 [0028] In certain embodiments that may be combined with the preceding embodiments, the Trichoderma fungal cell further contains reduced or no detectable activity of one or more additional proteases. In certain embodiments, the expression level of the one or more additional proteases in the Trichoderma fungal cell is reduced or eliminated. In certain embodiments, genes encoding the one or more additional protease in the Trichoderma fungal cell each have a mutation that reduces or eliminates the corresponding protease activity. In certain embodiments that may be combined with the preceding embodiments, the one or more additional protease encoding genes are selected from pep7, pep8, pep]], pep12, tppl, gap2, slp3, slp5, slp6, slp7, and slp8. [0029] In certain embodiments that may be combined with the preceding embodiments, the Trichoderma fungal cell further contains reduced or no detectable activity of ALG3. In certain embodiments, the gene encoding ALG3 in the Trichoderma fungal cell contains a mutation that reduces or eliminates the corresponding activity. In certain embodiments that may be combined with the preceding embodiments, the Trichoderma fungal cell further contains a polynucleotide encoding an a-1,2-mannosidase. In certain embodiments that may be combined with the preceding embodiments, the mutation reduces or eliminates the expression of the gene in the Trichoderma fungal cell. In certain embodiments that may be combined with the preceding embodiments, the mutation is a deletion of the gene in the Trichoderma fungal cell. In certain embodiments that may be combined with the preceding embodiments, the mutation is a deletion of the portion of the gene encoding the catalytic domain of the protease in the Trichoderma fungal cell. In certain embodiments that may be combined with the preceding embodiments, the mutation is a point mutation in the portion of the gene encoding the catalytic domain of the protease in the Trichoderma fungal cell. In certain embodiments that may be combined with the preceding embodiments, the Trichoderma fungal cell further contains a N acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain and the N-acetylglucosaminyltransferase II catalytic domain are encoded by a polynucleotide of the Trichoderma fungal cell. In certain embodiments, the N acetylglucosaminyltransferase I catalytic domain is encoded by a first polynucleotide and the N acetylglucosaminyltransferase II catalytic domain is encoded by a second polynucleotide of the 9 WO 2013/102674 PCT/EP2013/050126 Trichoderma fungal cell. In certain embodiments that may be combined with the preceding embodiments, the Trichoderma fungal cell further contains a polynucleotide encoding a mannosidase II. In certain embodiments, the proteases each have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 1, 17, 37, 58, 66, 82, 98, 118, 129, 166, and 182. In certain embodiments, the total protease activity in the Trichoderma fungal cell is reduced to 49% or less, 31% or less of the total protease activity of the corresponding Trichoderma parental cell in which the proteases do not have the reduced activity. In certain embodiments that may be combined with the preceding embodiments, the cell further contains a recombinant polynucleotide encoding a mammalian polypeptide produced at a level of at least 2-fold higher than the production level of the polypeptide in a corresponding parental Trichoderma fungal cell. In certain embodiments that may be combined with the preceding embodiments, the mammalian polypeptide is produced in a full length version at a level higher than the production level of the full-length version of the polypeptide in a corresponding parental Trichoderma fungal cell. [0030] Another aspect includes methods of improving heterologous polypeptide stability, by: a) providing the Trichoderma fungal cell of any of the preceding embodiments; and b) culturing the cell such that the heterologous polypeptide is expressed, where the heterologous polypeptide has increased stability compared to a host cell not containing the mutations of the genes encoding the proteases. Another aspect includes methods of making a heterologous polypeptide, by: a) providing the Trichoderma fungal cell of any of the preceding embodiments; b) culturing the host cell such that the heterologous polypeptide is expressed; and c) purifying the heterologous polypeptide. In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a carrier protein. In certain embodiments, the carrier protein is CBH1. DESCRIPTION OF THE FIGURES [0031] Figure 1 depicts a PAGE gel showing fractions eluted from affinity column purification of aspartic proteases. 10 WO 2013/102674 PCT/EP2013/050126 [0032] Figure 2 depicts a PAGE gel showing the results of incubating IgG with aspartic proteases. [0033] Figure 3 depicts Southern blot analysis showing the generation of single protease deletion strains M181 and M195. Figure 3A depicts the expected signal of pep] ORF: >8 kb from parent M127, no signal from transformants. Figure 3B depicts the expected signal of pep] 5'flank: >8 kb from parent M127, 4 kb from transformants. Figure 3C depicts the expected signal of pep] 3'flank: >8 kb from parent M127, 4.2 kb from transformants [0034] Figure 4 depicts Southern blot analysis showing the generation of rituximab antibody in the pep] deletion strain M182. Figure 4A depicts the expected signal of pep] ORF: >8 kb from parent M169, no signal from transformants. Figure 4B depicts the expected signal of bar: 1.0 + 1.7 kb from transformants, 3.1 kb from pTTv4l, nothing from M169. Figure 4C depicts the expected signal of bar: 1.8 + 2.8 kb from transformants, 3.1 kb from pTTv4l, nothing from M169. [0035] Figure 5 depicts a protein gel showing peak fractions from aspartic protease purifications of a pep] containing strain and Apep] strain. [0036] Figures 6A-B depict an immunoblot illustrating that deleting pep2 protease from the rituximab production strain M169 improved the (A) light and (B) heavy chain production in transformant 206A (strain M455). The bands representing the light chain fragment at 18 kD and the heavy chain fragment at 38 kD were more intense in strain M455 compared to the parent strain M169. [0037] Figure 7 graphically depicts the protease activity of supernatant from the rituximab production strain M169 and the pep2 protease deletion transformants 98A, 1 16A, 198A, 201A, and 206A (M455). Transformants 116A, 198A, and 206A show reduced protease activity against casein compared to their parent strain M169. [0038] Figure 8 depicts an immunoblot showing the effects of protease activity of PEP3 and PEP7 on MABO heavy chain and native IGF-1. Figure 8A depicts the effects of protease activity 11 WO 2013/102674 PCT/EP2013/050126 on MABO at pH 5.5. Figure 8B depicts the effects of protease activity on MABO at pH 4.5. Figure 8C depicts the effects of protease activity on native IGF-1 at pH 4.5 [0039] Figure 9 depicts a PAGE gel showing protease containing fractions purified from SIP peptide affinity column. [0040] Figure 10 depicts an immunoblot showing SIP protease activity on the MABO heavy chain. [0041] Figure 11 graphically depicts protease activity against casein with and without inhibitors. [0042] Figure 12 depicts an immunoblot showing the levels of MABO heavy and light chain production after deletion of each of sip], sip2, sip3, and gap] proteases. Figure 12A shows MABO heavy chain production. Figure 12B shows MABO light chain production. [0043] Figure 13 graphically depicts the fold improvement in MABO1 heavy and light chain production after deletion of each of sip], sip2, sip3, and gap] proteases. Each bar represents the average from several of the clones shown in Figure 12. [0044] Figure 14 depicts an immunoblot showing the levels of MABO production from the gap2 deletion strain M244. Figure 14A shows production of MABO heavy chain (HC). Figure 14B shows the production of MABO light chain (LC). [0045] Figure 15 depicts an immunoblot showing the levels of MABO antibody after incubation with Pichia supernatant containing the GAP2 protease. [0046] Figure 16 depicts an immunoblot showing the level of protease degradation of human IgG1. [0047] Figure 17 depicts the results of an MAB02 antibody zymogram from affinity purification with an aminobenzamidine column (purified fractions), and from supernatant samples (supernatant). 12 WO 2013/102674 PCT/EP2013/050126 [0048] Figure 18 depicts the generation of the Apep]Atsp] double protease deletion strain M219. Figure 18A depicts the expected signal of tsp] ORF: 6.4 kb from parent M196. Figure 18B depicts the expected signal of tsp] 5' flank: 3.9 kb from transformants, >8 kb from M196, 3.9 kb from pTTv72. Figure 18C depicts the expected signal of tsp] 3' flank: 2.8 kb from transformants, >8 kb from M196, 3.9 kb from pTTv72. [0049] Figure 19 depicts Southern blot analysis showing the generation of the Apep]Atsp2 double deletion strain M194. Figure 19A depicts the expected signal of tsp] ORF: kb from parent M181. Figure 19B depicts the expected signal of bar: 1.4 + 2.5 kb from transformants, 2.9 kb from pTTv42, nothing from M1 81. Figure 19C depicts the expected signal of bar: 1.9 + 3.2 kb from transformants, 2.9 kb from pTTv42, nothing from M181. [0050] Figure 20 graphically depicts normalized protease activity data from culture supernatants from each of the protease deletion supernatants and the parent strain M124. Protease activity was measured at pH 5.5 in first 5 strains and at pH 4.5 in the last three deletion strains. Protease activity is against green fluorescent casein. The six protease deletion strain has only 6% of the wild type parent strain and the 7 protease deletion strain protease activity was about 40% less than the 6 protease deletion strain activity. [0051] Figure 21A depicts the results of an MAB02 zymogram with aminobenzamidine purified fractions from fermentation supernatants. Figure 21B depicts an SDS PAGE gel (7%) of aminobenzamidine purified fractions from fermentation supernatants. [0052] Figure 22 depicts the results of an MAB02 zymogram assay with SBTI affinity purified fractions containing proteases. The major proteolytic activities appear white, where the protease has degraded the MAB02 antibody. Concentrated fraction 3 (cf3) and unconcentrated fractions 1-4 (fl-f4) were run in the zymogram gel. [0053] Figure 23 depicts an SDS PAGE gel showing SBTI affinity purified fractions containing proteases. Concentrated fractions cf3 and cf4 are shown in the gel. 13 WO 2013/102674 PCT/EP2013/050126 [0054] Figure 24 depicts an immunoblot showing the level of rituximab heavy chain degradation by SBTI purified proteases. [0055] Figure 25 depicts an immunoblot showing the level of antibody degradation when incubated overnight with subtilisin containing Pichia supernatants. Figure 25A shows protease degradation of rituximab heavy chain. Figure 25B shows protease degradation of MABO heavy chain. [0056] Figure 26 depicts Southern blot analysis showing the generation of the triple protease deletion strain M277. Figure 26A depicts the expected signal of sip] ORF: 6.5 kb from parents (M219, M228) only. Figure 26B depicts the expected signal of sip] 5'flank: 6.5 kb from parents, 3.3 kb from transformants, 4.4 kb from plasmid control pTTv126. Figure 26C depicts the expected signal of sip] 3'flank: 6.5 kb from parents, 2.3 kb from transformants, 4.4 kb from plasmid control pTTvl26. [0057] Figure 27 depicts an MAB02 zymogram assay showing the activity of protease deletion strain supernatants. White regions on the stained gel indicate an area of protease activity. [0058] Figure 28 graphically depicts total protease activity of protease deletion culture supernatants compared to wild type M124 activity. [0059] Figure 29 depicts Southern blots analysis showing the generation of the quadruple protease deletion strain M307. Figure 29A depicts the expected signal of gap] ORF: 4 kb from parent (M277 2A = M306) only. Figure 29B depicts the expected signal of gap] 5'flank: 5.5 kb from parent, 3.4 kb from transformants, 4.1 kb from plasmid control pTTv 117. Figure 29C depicts the expected signal of gap] 3'flank: 5.5 kb from parent, 3.1 kb from transformants, 4.1 kb from plasmid control pTTv 117. [0060] Figure 30 graphically depicts total protease activity in triple and quadruple deletion strains compared to wild type M124 strain. [0061] Figure 31 graphically depicts protease activity over time between the M304 triple deletion strain and the M371 quadruple deletion strain. 14 WO 2013/102674 PCT/EP2013/050126 [0062] Figure 32 depicts Southern blot analysis showing the generation of the quintuple protease deletion strain M369. Figure 32A depicts the expected signal of gap2 ORF: 4.9 kb from parent (M307). Figure 32B depicts the expected signal of gap2 5'flank: 4.9 kb from parent, 2.3 kb from transformant, 2.3 kb from plasmid control pTTvl45. Figure 32C depicts the expected signal of gap2 3'flank: 4.9 kb from parent, 3.8 kb from transformants, 3.8 kb from plasmid control pTTv145. Figure 32D depicts Southern blot analysis showing the generation of the pyr4 from the quintuple protease deletion strain M369, resulting in strain M381 (clone 14). The expected signal is gap2 5'flank: 1.5 kb from all strains, 4.1 kb from plasmid control pTTvl45. Figure 32E depicts Southern blot analysis showing the generation of the pyr4- from the quintuple protease deletion strain M369, resulting in strain M381 (clone 14). The expected signal is gap2 3'flank: 3.6 kb from M307, 2.7 kb from M369 + loopout clones, 3.8 kb from plasmid control pTTvl45. [0063] Figure 33 graphically depicts the protease activity of day 5 supernatants taken from shake flask cultures done with the 4 protease deletion strain M307, the 5 protease deletion strain M369, and the 6 protease deletion transformants lOB, 44B, 97A, 97B, and 120A. Fluorescent casein was incubated with the diluted supernatants in citrate buffer pH 4.5 to detect protease activity. [0064] Figure 34 depicts Southern blot analysis showing the generation of the 6-fold protease deletion strains M396 and M400. Figure 34A depicts the expected signal of pep4 ORF: 6.3 kb from M307 and M369. Figure 34B depicts the expected signal of pep4 ORF: 6.3 kb from M307 and M369, no signals from transformants. Figure 34C depicts the expected signal of pep4 5' flank: 6.3 kb from M307 and M369, 4.8 kb from transformants, 4.0 kb from pTTvl8l. Figure 34D depicts the expected signal of pep4 3' flank: 6.3 kb from M307 and M369, 2.1 kb from transformants, 4.0 kb from pTTvl8l. Figure 34E depicts Southern blot analysis showing the generation of pyr4- from 6-fold protease deletion strains M396. The expected signal of is pep4 3' flank: 6.3 kb from M307 and M369, 2.1 kb from repurified transformants, 4.9 kb from the loopout clones. 15 WO 2013/102674 PCT/EP2013/050126 [0065] Figure 35 depicts an immunoblot showing the amount of rituximab heavy chain fragments created in vitro by supernatant proteases. [0066] Figure 36 depicts an immunoblot showing degradation of heavy chain and light chain by supernatant samples from SBTI treated cultures and untreated controls. Figure 36A shows degradation of the heavy chain. Figure 36B shows the degradation of the light chain. [0067] Figure 37 depicts an immunoblot showing the level of degradation of heavy chain and light chain by supernatant samples from cultures treated with chymostatin and pepstatin A, or from untreated control cultures. Figure 37A shows the degradation of the light chain. Figure 37B shows degradation of the heavy chain. [0068] Figure 38 depicts the process of purifying antibodies from T. reesei culture supernatants. [0069] Figure 39 depicts an immunoblot showing improved the stability of antibody heavy (HC) and light chain (LC) from T. reesei cells containing a deletion of the pep] protease. Three model antibodies were tested in large shake flask supernatant (Apep1 and M124) and fermentation supernatant (pH 5.5; 28'C; 20 g/L spent grain extract, 60 g/L lactose). [0070] Figure 40 depicts an immunoblot showing improved production of the rituximab (Rx) heavy chain from T. reesei cells containing a deletion of the tsp] protease. Transformants 12-2A and 12-16A clearly show more heavy chain compared to the parent strain. [0071] Figure 41 depicts an immunoblot showing reduced MABO heavy chain degradation after overnight incubation with supernatant from the triple protease deletion strain M277. After overnight incubation in day 5 culture supernatant, there was 2.5-fold more heavy chain found in the triple protease deletion supernatant compared to supernatant from control strain M124, which has no protease deletions. When incubated in the 7 day culture supernatant, there was 4-fold more heavy chain found in the triple protease deletion supernatant compared to supernatant from control strain M124. 16 WO 2013/102674 PCT/EP2013/050126 [0072] Figure 42 depicts a degradation study of model proteins. Undiluted supernatant from the 6 protease deletion strain was used at pH 4.2 for spiking in pure model proteins (0.05 .g/ tl). 50 mM sodium citrate pH 4.0 spiked with model proteins (0.05 tg/ tl) is shown as a buffer control. The spiked supernatant and control were incubated for 20 hours at 37 0 C. 10 1tl of each sample was loaded into 18% SDS PAGE gels. The hGH ran at 22 kD, the IFNa2b ran at 19.4 kD, and the IGF1 ran at 7.5 kD. [0073] Figure 43 depicts stability testing of the MABO1 antibody heavy chain in supernatants from the 6 protease deletion strain. The MABO antibody was present in undiluted supernatant at 0.05 pg/pl. 10 pL of each sample was loaded to a 4-20% SDS PAGE gel. The heavy chain was stable after a 20 hour incubation at 37'C in supernatant from the 6 protease deletion strain at pH 4.2. The heavy chain was detected with anti-heavy chain IgG AP conjugated antibody (Sigma #A3188) diluted 1:30,000 in TBST. The full length heavy chain ran at 50 kD on the gel. [0074] Figure 44 depicts day 4 samples of human growth hormone from 24 well cultures with and without inhibitors, and supplements. 12 p1I of each supernatant was loaded. Primary antibody from Acris, catalog #AM00401PU-N mouse anti-hGH antibody (diluted to 2 Pg/ml in TBST) and BioRad (#170-6520) goat anti-mouse IgG AP conjugated secondary antibody diluted 1:10,000. The hGH standard (200 ng), Abcam catalog #ab51232. The full length hGH protein runs at 22 kD. [0075] Figure 45 depicts a phylogeny of aspartic proteases of T. reesei, Myceliophthora thermophila, Neurospora crassa, Penicillium chrysogenum, Aspergillus oryzae, A. nidulans, and A. niger. The alignment was created with Clustal Omega (http://www.ebi.ac.uk/Tools/msa/clustalo/) and the tree was calculated using average distance with BLOSUM62. [0076] Figure 46 depicts a a phylogeny of subtilisin proteases of T. reesei, Myceliophthora thermophila, Neurospora crassa, Penicillium chrysogenum, Aspergillus oryzae, A. nidulans, and A. niger. The alignment was created with Clustal Omega (http://www.ebi.ac.uk/Tools/msa/clustalo/) and the tree was calculated using average distance 17 WO 2013/102674 PCT/EP2013/050126 with BLOSUM62."pyr" means pyrolysin, "prKsf3" means proteinase K, subfamily 3; prtA, prtK, prtJ, prtF, and prtBCI mean subfamilies as described in Bryant et al. (2009) BMC Evolutionary Biology 9:168, doi:10.1186/1471-2148-9-168, Figure 5 and additional file no. 8. [0077] Figure 47 depicts a phylogeny of glutamic proteases of T. reesei, Myceliophthora thermophila, Neurospora crassa, Penicillium chrysogenum, Aspergillus oryzae, A. nidulans, and A. niger. The alignment was created with Clustal Omega (http://www.ebi.ac.uk/Tools/msa/clustalo/) and the tree was calculated using average distance with BLOSUM62. [0078] Figure 48 depicts a phylogeny of sedolisin proteases of T. reesei, Myceliophthora thermophila, Neurospora crassa, Penicillium chrysogenum, Aspergillus oryzae, A. nidulans, and A. niger. The alignment was created with Clustal Omega (http://www.ebi.ac.uk/Tools/msa/clustalo/) and the tree was calculated using average distance with BLOSUM62. As slp7 resembles sedolisin proteases, it is included in the tree. Aspergillus fumigatus sequences are included to aid the determination of the relationships between sedolisins. The abbreviations sedA/B/C/D/E in front of each protease are based on Reichard et al. (2006) APPLIED AND ENVIRONMENTAL MICROBIOLOGY, Vol. 72, p. 1739-1748, Figure 4, from which BLAST search with A. fumigatus sedolisin the corresponding protease was retrieved.. [0079] Figure 49: A: Schematic drawings for the expression plasmids pTTv67 and pTTv99. The MABO heavy chain is contained within in the pTTv67 vector and the light chain is contained within the pTTv99 vector. B: Schematic drawing for the expression vector pTTv223. The MABO heavy and light chain is contained within the pTTv223 vector. [0080] Figure 50: A: Western blot analysis MABO light and heavy chain production in pH 5.2 in a fed batch fermentation of the MABO production strain M507. The antibodies used were Sigma A3188 against the heavy chain (left blot) and Sigma A3813 against the light chain (right blot), both at 1:10,000 dilutions. Sample codes denote fermentation time in days. 0.1 PI of supernatant was loaded into each lane in both blots. B: Western blot analysis of MABO light and heavy chain production in the fed batch fermentation of the MABO production strain M507 at 18 WO 2013/102674 PCT/EP2013/050126 pH 5.5. The antibodies used were Sigma A3188 against the heavy chain (blot to the left) and Sigma A3813 against the light chain (blot to the right), both at 1:10,000 dilutions. Sample codes denote fermentation time in days. 0.1 p1I of supernatant was loaded into each lane in both blots. [0081] Figure 51 . Western blot analysis MABO light and heavy chain production in strains M304 in the fed batch fermentation bio00503b at pH 5.5. The antibodies used were Sigma A3188 against the heavy chain and Sigma A3813 against the light chain. The day 8 from the M304 fermentation bio00477b was included as a control. Sample codes denote fermentation time in days. 0.1 p1I of supernatant was loaded in both blots. The uppermost immunoblot is the heavy chain and lower immunoblot is the light chain. [0082] Figure 52. The pTTv204 RNAi expression vector. [0083] Figure 53: Immunoblot detecting MABO heavy chain production in strains expressing RNAi that knocks down slp2 expression. [0084] Figure 54 A depicts quantification of the IFN-a 2b expression level from the day 3 sample of M401 fermentation. 1 l /2 l /4 l of supernatant were loaded to a 4-20% SDS PAGE gel. Immunoblotting was done with Abcam (#ab9386) anti-IFN-a 2b antibody diluted to 1 Pg/ml in TBST. The secondary antibody from Bio-rad (#170-6520) goat anti-mouse IgG AP conjugated secondary antibody diluted 1:5000 in TBST. The protein standards were loaded on the gel corresponding 50 ng, 100 ng and 200 ng of full length IFN-a 2b. Densitometric quantification was done with Totallab Quant TL100 software. For the quantification 2 PI sample was most representative. Full length IFN-a 2b control (100 ng) runs at 19.3 kD and carrier bound IFN-a 2b at 70 kDa [0085] Figure 54 B depicts immunoblot analysis for day 3 - 6 samples of M577 and M652 fermentation cultures. 0.2 l of growth supernatant was loaded to a 4-20% SDS PAGE gel. Immunoblotting was done with Abcam (#ab9386) anti-IFN-a 2b antibody diluted to 1 Pg/ml in TBST. The secondary antibody from Bio-rad (#170-6520) goat anti-mouse IgG AP conjugated 19 WO 2013/102674 PCT/EP2013/050126 secondary antibody diluted 1:5000 in TBST. Full length IFN-a 2b control (100 ng) runs at 19.3 kD and carrier bound IFN-a 2b at 70 kDa [0086] Figure 55 depicts quantification of the IFN-a 2b expression level from the day 4 (M577 fermentation) and day 3 (M652 fermentation) samples. 0.05 P1 and 0.1 P1 of supernatant were loaded of each sample to a 4-20% SDS PAGE gel. Immunoblotting was done with Abcam (#ab9386) anti-IFN-a 2b antibody diluted to 1 pg/ml in TBST. The secondary antibody from Bio rad (#170-6520) goat anti-mouse IgG AP conjugated secondary antibody diluted 1:5000 in TBST. The protein standards were loaded on the gel corresponding 50 ng, 100 ng and 200 ng of full length IFN-a 2b. Densitometric quantification was done with Totallab Quant TL100 software. For the quantification 0,1 l samples were most representative. Full length IFN-a 2b control (100 ng) runs at 19.3 kD and carrier bound IFN-a 2b at 70 kDa DETAILED DESCRIPTION [0087] The present invention relates to improved methods of generating recombinant heterologous polypeptides in filamentous fungal cells that have reduced or no activity of at least three proteases. The present invention is based in part upon the surprising discovery that reducing the activity of a specific combination of endogenous proteases in filamentous fungal cells increases the expression and stability of a variety of recombinantly expressed heterologous proteins, such as immunoglobulins and growth factors. While others have created Trichoderma fungal cells with one or more proteases inactivated, they have not provided guidance as to which proteases are most relevant to increasing the expression and stability of specific types of proteins, such as mammalian proteins. For example, W02011/075677 discloses certain proteases that can be knocked out in Trichoderma and even discloses Trichoderma fungal cells that are deficient in multiple proteases. However, W02011/075677 does not provide any guidance regarding which of the proteases have an adverse impact on the expression and stability of mammalian proteins, such as immunoglobulins or growth factors, as no examples of expression of any mammalian proteins are described therein. Moreover, W02011/075677 only discloses heterologous expression of a single fungal protein in each of three different fungal strains deficient in a single protease. Thus, one of skill in the art would likely read W02011/075677 as teaching that 20 WO 2013/102674 PCT/EP2013/050126 inactivating each single protease would be sufficient for heterologous protein production. Yoon et al (2009, Appl. Microbiol Biotechnol 82: 691-701, 2010: Appl. Microbiol Biotechnol DOI 10.1007/s00253-010-2937-0) reported the construction of quintuple and ten fold protease gene disruptants for heterologous protein production in Aspergillus oryzae. The 10 protease disruptant cells improve the production yield of chymosin by only 3.8 fold, despite the high number of disrupted protease genes. Van den Hombergh et al reported a triple protease gene disruptant of Aspergillus niger. While the data show a reduction in protease activity, there is no example of any mammalian protein production described herein. [0088] Applicants have surprisingly shown that multiple proteases are relevant to reduction of total protease activity, increasing production of heterologous proteins and stabilizing the heterologous proteins after expression, in filamentous fungal cells, such as Trichoderma fungal cells. In particular, the inventors have identified proteases that are actually expressed in Trichoderma fungal cells (as opposed to merely being coded for in the genome) by purifying these proteases and determining which have activities that are most relevant in degrading heterologous proteins, such as mammalian proteins. Additionally, the inventors confirmed that deleting the genes responsible for the particular protease activities achieved a substantial reduction in total protease activity, which correlates to an increase in protein stabilization in terms of both quantity and quality of proteins produced in filamentous fungal cells containing such deletions, and resulted in an increase in the production of full length heterologous proteins in the cells. It was also found that Trichoderma fungal cells engineered to reduce the activity of at least three protease genes resulted in an unexpected, synergistic increase in the production of full length mammalian proteins, such as antibodies, therapeutic protein or antibody variants such Fab or single domain antibodies. In other words, the amount of full length mammalian protein produced was greater than the sum of the amounts produced in Trichoderma fungal cells containing only one or two protease gene deletions. Thus, in contrast to W02011/075677, the inventors have shown that production of intact heterologous proteins in filamentous fungal cells, such as Trichoderma fungal cells, can be achieved by reducing or eliminating the activity of at least three proteases in the cells. 21 WO 2013/102674 PCT/EP2013/050126 [0089] Accordingly, certain aspects of the present disclosure provide filamentous fungal cells that produce increased levels of a heterologous protein by having reduced or no activity of at least three proteases, where the cell further contains a recombinant polynucleotide encoding a heterologous polypeptide produced at a level of at least 2-fold higher than the production level of the polypeptide in a corresponding parental filamentous fungal cell in which the proteases do not have the reduced activity. In other words, the desired increase in the level of the heterologous protein production is determinable by comparing the production level of the heterologous protein in a filamentous fungal cell having the reduced activity of at least three proteases, to that of a filamentous fungal cell which does not have such reduced activity, but is otherwise identical to the cell exhibiting the increased level. [0090] Other aspects of the present disclosure provide methods of improving heterologous polypeptide stability, by: a) providing a filamentous fungal cell of the present disclosure having reduced or no activity of at least three proteases, where the cell further contains a recombinant polynucleotide encoding a heterologous polypeptide; and b) culturing the cell such that the heterologous polypeptide is expressed, where the heterologous polypeptide has increased stability compared to a host cell not containing the mutations of the genes encoding the proteases. [0091] Still other aspects of the present disclosure provide methods of making a heterologous polypeptide, by: a) providing a filamentous fungal cell of the present disclosure having reduced or no activity of at least three proteases, where the cell further contains a recombinant polynucleotide encoding a heterologous polypeptide; b) culturing the host cell such that the heterologous polypeptide is expressed; and c) purifying the heterologous polypeptide. [0092] Certain aspects of the present disclosure also provide Trichoderma fungal cells that produce increased levels of a mammalian polypeptide by having reduced or no activity of at least three proteases selected from pep], pep2, pep3, pep4, pep5, pep8, pep]1, pep12, tspl, sip1, sip2, gap], and gap2, where the cell further contains a recombinant polynucleotide encoding a mammalian polypeptide produced at a level of at least 2-fold higher than the production level of the polypeptide in a corresponding parental Trichoderma fungal cell in which the proteases do not have the reduced activity. In other words, the desired increase in the level of the heterologous 22 WO 2013/102674 PCT/EP2013/050126 protein production is determinable by comparing the production level of the heterologous protein in a Trichoderma fungal cell having the reduced activity of at least three proteases, to that of a Trichoderma fungal cell which does not have such reduced activity, but is otherwise identical to the cell exhibiting the increased level. [0093] Other aspects of the present disclosure provide methods of improving mammalian polypeptide stability, by: a) providing a Trichoderma fungal cell of the present disclosure having reduced activity of at least three proteases, where the cell further contains a recombinant polynucleotide encoding a mammalian polypeptide; and b) culturing the cell such that the mammalian polypeptide is expressed, where the mammalian polypeptide has increased stability compared to a host cell not containing the mutations of the genes encoding the proteases. [0094] Further aspects of the present disclosure provide methods of making a mammalian polypeptide, by: a) providing a Trichoderma fungal cell of the present disclosure having reduced activity of at least three protease, where the cell further contains a recombinant polynucleotide encoding a mammalian polypeptide; b) culturing the host cell such that the mammalian polypeptide is expressed; and c) purifying the mammalian polypeptide. Definitions [0095] As used herein, an "immunoglobulin" refers to a multimeric protein containing a heavy chain and a light chain covalently coupled together and capable of specifically combining with antigen. Immunoglobulin molecules are a large family of molecules that include several types of molecules such as IgM, IgD, IgG, IgA, and IgE. [0096] As used herein, an "antibody" refers to intact immunoglobulin molecules, as well as fragments thereof which are capable of binding an antigen. These include hybrid (chimeric) antibody molecules (see, e.g., Winter et al. Nature 349:293-99225, 1991; and U.S. Pat No. 4,816,567 226); F(ab')2 and F(ab) fragments and Fv molecules; non-covalent heterodimers [227, 228]; single-chain Fv molecules (scFv) (see, e.g., Huston et al. Proc. Natl. A cad. Sci. U.S.A. 85:5897-83, 1988); dimeric and trimeric antibody fragment constructs; minibodies (see, e.g., Pack et al. Biochem 31, 1579-84, 1992; and Cumber et al. J. Immunology 149B, 120-26, 1992); 23 WO 2013/102674 PCT/EP2013/050126 humanized antibody molecules (see e.g., Riechmann et al. Nature 332, 323-27, 1988; Verhoeyan et al. Science 239, 1534-36, 1988; and GB 2,276,169); and any functional fragments obtained from such molecules, as well as antibodies obtained through non-conventional processes such as phage display. Preferably, the antibodies are monoclonal antibodies. Methods of obtaining monoclonal antibodies are well known in the art. [0097] As used herein, a "peptide" and a "polypeptide" are amino acid sequences including a plurality of consecutive polymerized amino acid residues. For purpose of this invention, typically, peptides are those molecules including up to 50 amino acid residues, and polypeptides include more than 50 amino acid residues. The peptide or polypeptide may include modified amino acid residues, naturally occurring amino acid residues not encoded by a codon, and non naturally occurring amino acid residues. As used herein, "protein" may refer to a peptide or a polypeptide of any size. Proteases of the Invention [0098] The invention described herein relates to filamentous fungal cells, such as Trichoderma fungal cells, that produce increased levels of a heterologous polypeptide, such as a mammalian polypeptide, by having reduced or no detectable activity of at least three proteases found in the cells. Such proteases found in filamentous fungal cells that express a heterologous polypeptide normally catalyze significant degradation of the expressed recombinant polypeptides. Thus, by reducing or eliminating the activity of proteases in filamentous fungal cells that express a heterologous polypeptide , the stability of the expressed polypeptide is increased, resulting in an increased level of production of the polypeptide, and in some circumstances, improved quality of the produced polypeptide (e.g., full-length instead of degraded). [0099] Proteases including, without limitation, aspartic proteases, trypsin-like serine proteases, subtilisin proteases, glutamic proteases, and sedolisin proteases. Such proteases may be identified and isolated from filamentous fungal cells and tested to determine whether reduction in their activity affects the production of a recombinant polypeptide from the filamentous fungal cell. Methods for identifying and isolating proteases are well known in the art, and include, 24 WO 2013/102674 PCT/EP2013/050126 without limitation, affinity chromatography, zymogram assays, and gel electrophoresis. An identified protease may then be tested by deleting the gene encoding the identified protease from a filamentous fungal cell that expresses a recombinant polypeptide, such a heterologous or mammalian polypeptide, and determining whether the deletion results in a decrease in total protease activity of the cell, for example, to a level of 49% or less, or 31% or less, of the total protease activity of the corresponding parental filamentous fungal cell; and an increase in the level of production of the expressed recombinant polypeptide, for example two-fold higher than the production level in the corresponding parental filamentous fungal cell. Methods for deleting genes, measuring total protease activity, and measuring levels of produced protein are well known in the art and include the methods described herein. The "corresponding parental filamentous fungal cell" refers to the corresponding cell in which the proteases do not have reduced or eliminated activity. Aspartic Proteases [00100] Aspartic proteases are enzymes that use an aspartate residue for hydrolysis of the peptide bonds in polypeptides and proteins. Typically, aspartic proteases contain two highly conserved aspartate residues in their active site which are optimally active at acidic pH. Aspartic proteases from eukaryotic organisms such as Trichoderma fungi include pepsins, cathepsins, and renins. Such aspartic proteases have a two-domain structure, which is thought to arise from an ancestral gene duplication. Consistent with such a duplication event, the overall fold of each domain is similar, though the sequences of the two domains have begun to diverge. Each domain contributes one of the catalytic aspartate residues. The active site is in a cleft formed by the two domains of the aspartic proteases. Eukaryotic aspartic proteases further include conserved disulfide bridges, which can assist in identification of the polypeptides as being aspartic acid proteases. [00101] Nine aspartic proteases have been identified in Trichoderma fungal cells: pep] (tre74156); pep2 (tre53961); pep3 (tre121133); pep4 (tre77579), pep5 (tre81004), and pep7 (tre58669), pep8 (tre122076), pep]] (tre121306) and pep12 (trel 19876). 25 WO 2013/102674 PCT/EP2013/050126 Pep] [00102] Examples of suitable pep] proteases include, without limitation, Trichoderma reesei pep] (SEQ ID NO: 1), Hypocrea lixii gil11558498 (SEQ ID NO: 2), Trichoderma asperellum gil47027997 (SEQ ID NO: 3), Trichoderma atroviride jgilTriat2I297887 (SEQ ID NO: 4), Trichoderma virens jgilTriviGv29_8_2181777 (SEQ ID NO: 5), Aspergillusfumigatus jgilTrire2lafm:Afu5g13300 (SEQ ID NO: 6), Aspergillus oryzae gil94730408 (SEQ ID NO: 7), Metarhizium anisopliae gil322712783 (SEQ ID NO: 8), Gibberella zeae gil46126795 (SEQ ID NO: 9), Fusarium venenatum gil18448713 (SEQ ID NO: 10), Fusarium oxysporum gil342879173 (SEQ ID NO: 11), Grosmannia clavigera gil320591399 (SEQ ID NO: 12), Verticillium alboatrum gil302422750 (SEQ ID NO: 13), Chaetomium globosum gil116182964 (SEQ ID NO: 14), Neurospora crassa gil85110723 (SEQ ID NO: 15), Neurospora tetrasperma gil336463990 (SEQ ID NO: 16), Myceliophthora thermophila gi367030924 (SEQ ID NO: 491), Penicillium chrysogenum gi255953325 (SEQ ID NO: 492), Aspergillus niger gi350639535 (SEQ ID NO: 493), Aspergillus nidulans gi67541436 (SEQ ID NO: 494), and homologs thereof. [00103] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep] protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 1-16, SEQ ID NOs:491-494. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 1-16, SEQ ID NOs:491-494. [00104] In some embodiments, pep] is T. reesei pep]. The amino acid sequence encoded by T. reesei pep] is set forth in SEQ ID NO: 1. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 1. In further embodiments, the protease has 100% identity to SEQ ID NO: 1. Pep2 26 WO 2013/102674 PCT/EP2013/050126 [00105] Examples of suitable pep2 proteases include, without limitation, Trichoderma reesei pep2 (SEQ ID NO: 182), T atroviride jgilTriat2l142040 (SEQ ID NO: 183), T virens jgilTriviGv29_8_2153481 (SEQ ID NO: 184), Cordyceps militaris CMO1 gil346326575 (SEQ ID NO: 185), Neurospora crassa gi 85111370 (SEQ ID NO: 495), and homologs thereof. [00106] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep2 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 182-185, SEQ ID NO:495. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 182-185, SEQ ID NO:495. [00107] In some embodiments, pep2 is T. reesei pep2. The amino acid sequence encoded by T. reesei pep2 is set forth in SEQ ID NO: 182. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 182. In further embodiments, the protease has 100% identity to SEQ ID NO: 182. Pep3 [00108] Examples of suitable pep3 proteases include, without limitation, Trichoderma reesei pep3 (SEQ ID NO: 17), T atroviride jgilTriat2 (SEQ ID NO: 18), T virens, jgilTriviGv29_8_2 (SEQ ID NO: 19), Hypocrea lixii gi1145583125 (SEQ ID NO: 20), Trichoderma asperellum gil51860175 (SEQ ID NO: 21), Aspergillus niger gil317025164 (SEQ ID NO: 22), Aspergillus fumigatus gil159122534 (SEQ ID NO: 23), Aspergillus niger gil134054572 (SEQ ID NO: 24), Cordyceps militaris, gil346318620 (SEQ ID NO: 25), Glomerella graminicola gil310800156 (SEQ ID NO: 26), Fusarium oxysporum gil342871221 (SEQ ID NO: 27), Grosmannia clavigera gil320591121 (SEQ ID NO: 28), Botryotiniafuckeliana gil12002205 (SEQ ID NO: 29), Thielavia terrestris gil346997107 (SEQ ID NO: 30), Sclerotinia sclerotiorum gil156055954 (SEQ ID NO: 31), Chaetomium globosum gil116197829 (SEQ ID NO: 32), Neurospora tetrasperma gil336472132 (SEQ ID NO: 33), Neurospora crassa gil85102020 (SEQ ID NO: 34), Neosartorya 27 WO 2013/102674 PCT/EP2013/050126 fischeri gi1119467426 (SEQ ID NO: 35), Penicillium marneffei gil212534792 (SEQ ID NO: 36), M. thermophila gi367025909 (SEQ ID NO: 496), P. chrysogenum gi255947264 (SEQ ID NO: 497), A. oryzae 391870123 (SEQ ID NO: 498), and homologs thereof. [00109] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep3 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 17-36, SEQ ID NOs:496-498. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 17-36, SEQ ID NOs:496-498. [00110] In some embodiments, pep3 is T. reesei pep3. The amino acid sequence encoded by T. reesei pep3 is set forth in SEQ ID NO: 17. In other embodiments, a protease of the present disclosure has an amino acid sequence having50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 17. In further embodiments, the protease has 100% identity to SEQ ID NO: 17. Pep4 [00111] Examples of suitable pep4 proteases include, without limitation, Trichoderma reesei pep4 (SEQ ID NO: 37), Tvirens jgilTriviGv29_8_2 (SEQ ID NO: 38), T atroviride jgilTriat2 (SEQ ID NO: 39), Trichoderma aureoviride gil193735605 (SEQ ID NO: 40), Aspergillus niger gil145232965 (SEQ ID NO: 41), Aspergillusfumigatus gil70999520 (SEQ ID NO: 42), Aspergillus clavatus gil121705756 (SEQ ID NO: 43), Nectria haematococca gil302899226 (SEQ ID NO: 44), Glomerella graminicola gil310796316 (SEQ ID NO: 45), Cordyceps militaris gil346322842 (SEQ ID NO: 46), Gibberella zeae gil46138535 (SEQ ID NO: 47), Metarhizium anisopliae gil322708430 (SEQ ID NO: 48), Fusarium oxysporum gil342882947 (SEQ ID NO: 49), Metarhizium acridum gil322700747 (SEQ ID NO: 50), Verticillium dahliae, gil346973691 (SEQ ID NO: 51), Botryotiniafuckeliana gi1154309857 (SEQ ID NO: 52), Chaetomium globosum gil116203505 (SEQ ID NO: 53), Thielavia terrestris gil347001590 (SEQ ID NO: 54), Magnaporthe oryzae gil39973863 (SEQ ID NO: 55), Tuber melanosporum gil296417651 (SEQ 28 WO 2013/102674 PCT/EP2013/050126 ID NO: 56), Neurospora crassa gil85094599 (SEQ ID NO: 57), M. thermophila gi367031892 gi255947264 (SEQ ID NO: 499), P. chrysogenum gi255936729 gi255947264 (SEQ ID NO: 500), A. oryzae gil69770745 gi255947264 (SEQ ID NO: 501), A. nidulans gi67524891 gi255947264 (SEQ ID NO: 502), and homologs thereof. [00112] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep4 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 37-57, SEQ ID NOs:499-502. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 37-57, SEQ ID NOs:499-502. [00113] In some embodiments, pep4 is T. reesei pep4. The amino acid sequence encoded by T. reeseipep4 is set forth in SEQ ID NO: 37. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 37. In further embodiments, the protease has 100% identity to SEQ ID NO: 37. Pep5 [00114] Examples of suitable pep5 genes include, without limitation, Trichoderma reesei pep5 (SEQ ID NO: 58), Tvirens jgilTriviGv29_8_2 (SEQ ID NO: 59), T atroviride jgilTriat2l277859 (SEQ ID NO: 60), Metarhizium acridum gil322695806 (SEQ ID NO: 61), Fusarium oxysporum gil156071418 (SEQ ID NO: 62), Cordyceps militaris gil346324830 (SEQ ID NO: 63), Gibberella zeae gil46124247 (SEQ ID NO: 64), Verticillium dahliae gil346978752 (SEQ ID NO: 65), M. thermophila gi367019798 (SEQ ID NO: 503), and homologs thereof. [00115] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep5 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 58-65, SEQ ID NO:503. In some 29 WO 2013/102674 PCT/EP2013/050126 embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 58-65, SEQ ID NO:503. [00116] In some embodiments, pep5 is T. reesei pep5. The amino acid sequence encoded by T. reeseipep5 is set forth in SEQ ID NO: 58. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 58. In further embodiments, the protease has 100% identity to SEQ ID NO: 58. Pep7 [00117] Examples of suitable pep7 genes include, without limitation, Trichoderma reesei pep7 (SEQ ID NO: 186), Trichoderma atroviride jgilTriat2 (SEQ ID NO: 187), Trichoderma virens jgilTriviGv29_8_2 (SEQ ID NO: 188), Glomerella graminicola gil310800487 (SEQ ID NO: 189), Metarhizium acridum gil322700577 (SEQ ID NO: 190), Thielavia terrestris gil347003264 (SEQ ID NO: 191), Podospora anserine gi1171680938 (SEQ ID NO: 192), Chaetomium thermophilum gil340905460 (SEQ ID NO: 193), Verticillium dahliae gil346975960 (SEQ ID NO: 194), Myceliophthora thermophila gil347009870, gi367026634 (SEQ ID NO: 195), Neurospora crassa gil85090078 (SEQ ID NO: 196), Magnaporthe oryzae gil39948622 (SEQ ID NO: 197), Chaetomium globosum gil116191517 (SEQ ID NO: 198), Magnaporthe oryzae gil39970765 (SEQ ID NO: 199), A. nidulans gi67522232 (SEQ ID NO: 504), A. niger gi350630464 (SEQ ID NO: 505), A. oryzae gi317138074 (SEQ ID NO: 506), and homologs thereof. [00118] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep7 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 186-199, SEQ ID NOs:504-506. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 186-199, SEQ ID NOs:504-506. [00119] In some embodiments, pep7 is T. reeseipep7. The amino acid sequence encoded by T. reesei pep7 is set forth in SEQ ID NO: 186. In other embodiments, a protease of the present 30 WO 2013/102674 PCT/EP2013/050126 disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 186. In further embodiments, the protease has 100% identity to SEQ ID NO: 186. Pep8 [00120] Examples of suitable pep8 genes include, without limitation, Trichoderma reesei pep8 EGR48424 (SEQ ID NO: 507), Trichoderma virens EHK19238 (SEQ ID NO: 508), Trichoderma atroviride EHK40047 (SEQ ID NO: 509), Neurospora tetrasperma EG053367 (SEQ ID NO: 510), Myceliophthora thermophila XP_003658897 (SEQ ID NO: 511), Neurospora crassa XP_965343(SEQ ID NO: 512), Metarhizium anisopliae EFZ03501 (SEQ ID NO: 513), Thielavia terrestris XP_003656869 (SEQ ID NO: 514), Fusarium oxysporum EGU79769 (SEQ ID NO: 515), and Gibberella zeae XP_381566 (SEQ ID NO: 516), Magnaporthe oryzae XP_"3714540.1 (SEQ ID NO:517), P. chrysogenum XP_002557331 (SEQ ID NO: 518), A. oryzae XP_001822899.1 (SEQ ID NO: 519), A. nidulans XP_664091.1 (SEQ ID NO: 520), A. niger EHA24387.1 (SEQ ID NO: 521), and homologs thereof. [00121] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep8 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 507-521. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 507-521. [00122] In some embodiments, pep8 is T. reesei pep8. The amino acid sequence encoded by T. reeseipep8 is set forth in SEQ ID NO: 507. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 507. In further embodiments, the protease has 100% identity to SEQ ID NO: 507. Pep]] 31 WO 2013/102674 PCT/EP2013/050126 [00123] Examples of suitable pepIgenes include, without limitation, Trichoderma reesei pep]1 EGR49498 (SEQ ID NO: 522), Trichoderma virens EHK26120 (SEQ ID NO: 523), Trichoderma atroviride EHK41756 (SEQ ID NO: 524), Fusarium pseudograminearum EKJ74550 (SEQ ID NO: 525), Metarhizium acridum EFY91821 (SEQ ID NO: 526), and Gibberella zeae XP_38415 1(SEQ ID NO: 527), M. thermophila XP_003667387.1(SEQ ID NO: 528) , N. crassa XP_960328.1 (SEQ ID NO: 529), and homologs thereof. [00124] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep]] protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 522-529. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 522-529. [00125] In some embodiments, pep]1 is T. reesei pep8. The amino acid sequence encoded by T. reesei pep]1 is set forth in SEQ ID NO: 522. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 522. In further embodiments, the protease has 100% identity to SEQ ID NO: 522. Pep12 [00126] Examples of suitable pep12 genes include, without limitation, Trichoderma reesei pep12 EGR52517 (SEQ ID NO: 530), Trichoderma virenspep12 EHK18859 (SEQ ID NO: 531), Trichoderma atroviride pep12 EHK45753 (SEQ ID NO: 532), Fusarium pseudograminearum pep12 EKJ73392 (SEQ ID NO: 533), Gibberella zeaepep12 XP_388759 (SEQ ID NO: 534), and Metarhizium anisopliaepep]2 EFY95489 (SEQ ID NO: 535), N. crassa XP_964574.1 (SEQ ID NO: 536), M. thermophila XP_003659978.1 (SEQ ID NO: 537), and homologs thereof. [00127] Accordingly, in certain embodiments, a protease of the present disclosure, typically a pep12 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an 32 WO 2013/102674 PCT/EP2013/050126 amino acid sequence selected from SEQ ID NOs: 530-537. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 530-537. [00128] In some embodiments, pep8 is T. reesei pep]2. The amino acid sequence encoded by T. reesei pep12 is set forth in SEQ ID NO: 530. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 530. In further embodiments, the protease has 100% identity to SEQ ID NO: 530. Trypsin-Like Serine Proteases [00129] Trypsin-like serine proteases are enzymes with substrate specificity similar to that of trypsin. Trypsin-like serine proteases use a serine residue for hydrolysis of the peptide bonds in polypeptides and proteins. Typically, trypsin-like serine proteases cleave peptide bonds following a positively-charged amino acid residue. Trypsin-like serine proteases from eukaryotic organisms such as Trichoderma fungi include trypsin 1, trypsin 2, and mesotrypsin. Such trypsin-like serine proteases generally contain a catalytic triad of three amino acid residues (such as histidine, aspartate, and serine) that form a charge relay that serves to make the active site serine nucleophilic. Eukaryotic trypsin-like serine proteases further include an "oxyanion hole" formed by the backbone amide hydrogen atoms of glycine and serine, which can assist in identification of the polypeptides as being trypsin-like serine proteases. [00130] One trypsin-like serine protease has been identified in Trichoderma fungal cells: tsp] (tre73897). As discussed below, tsp] has been demonstrated to have a significant impact on expression of recombinant polypeptides, such as immunoglobulins. [00131] As discussed below in Example 3, serine proteases were purified from Trichoderma and shown to have multiple protease activities that degrade mammalian proteins. Of these activities, tsp] was identified as a trypsin-like serine protease. The tsp] protease gene was then deleted from Trichoderma fungal cells and it was demonstrated that deleting tsp] achieved a significant reduction in total protease activity resulting in increased stabilization of mammalian proteins produced by the cells. 33 WO 2013/102674 PCT/EP2013/050126 [00132] Examples of suitable tsp] proteases include, without limitation, Trichoderma reesei tsp] (SEQ ID NO: 66), Trichoderma atroviride jgilTriat2l298187 (SEQ ID NO: 67), jgilTriviGv29_8_2 (SEQ ID NO: 68), Hypocrea lixii gi1145583579 (SEQ ID NO: 69), Hypocrea lixii gi163025000 (SEQ ID NO: 70), Sclerotinia sclerotiorum gi1156052735 (SEQ ID NO: 71), Botryotiniafuckeliana gi1154314937 (SEQ ID NO: 72), Phaeosphaeria nodorum gi1169605891 (SEQ ID NO: 73), Leptosphaeria maculans gil312219044 (SEQ ID NO: 74), Verticillium dahliae gil37992773 (SEQ ID NO: 75), Cochliobolus carbonum gil1072114 (SEQ ID NO: 76), Metarhizium acridum gil322695345 (SEQ ID NO: 77), Metarhizium anisopliae gil4768909 (SEQ ID NO: 78), gi1464963 (SEQ ID NO: 79), Gibberella zeae gil46139299 (SEQ ID NO: 80), Metarhizium anisopliae (SEQ ID NO: 81), A. nidulans gi67523821 (SEQ ID NO: 538) and homologs thereof. [00133] Accordingly, in certain embodiments, a protease of the present disclosure, typically tsp] protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 66-81, SEQ ID NO:538. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 66-81, SEQ ID NO:538. [00134] In some embodiments, tsp] is T. reesei tsp]. The amino acid sequence encoded by T. reesei tsp] is set forth in SEQ ID NO: 66. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 66. In further embodiments, the protease has 100% identity to SEQ ID NO: 66. Subtilisin Proteases [00135] Subtilisin proteases are enzymes with substrate specificity similar to that of subtilisin. Subtilisin proteases use a serine residue for hydrolysis of the peptide bonds in polypeptides and proteins. Generally, subtilisin proteases are serine proteases that contain a catalytic triad of the three amino acids aspartate, histidine, and serine. The arrangement of these catalytic residues is 34 WO 2013/102674 PCT/EP2013/050126 shared with the prototypical subtilisin from Bacillus licheniformis. Subtilisin proteases from eukaryotic organisms such as Trichoderma fungi include furin, MBTPS 1, and TPP2. Eukaryotic trypsin-like serine proteases further include an aspartic acid residue in the oxyanion hole. Subtilisin protease sip7 resembles also sedolisin protease tppl. [00136] Seven subtilisin proteases have been identified in Trichoderma fungal cells: sip] (tre51365); sip2 (tre123244); sip3 (tre123234); sip5 (tre64719), sip6 (tre121495), sip7 (tre123865), and sip8 (tre58698). Sip] [00137] Examples of suitable sip] proteases include, without limitation, Trichoderma reesei sip] (SEQ ID NO: 82), Trichoderma atroviride jgilTriat2 (SEQ ID NO: 83), Trichoderma atroviride jgilTriat2 (SEQ ID NO: 84), Trichoderma virens jgilTriviGv29_8_2 (SEQ ID NO: 85), Hypocrea lixii gi1145583581 (SEQ ID NO: 86), Metarhizium acridum gil322694632 (SEQ ID NO: 87), Fusarium oxysporum gil342877080 (SEQ ID NO: 88), Gibberella zeae gil46139915 (SEQ ID NO: 89), Epichloefestucae gil170674476 (SEQ ID NO: 90), Nectria haematococca gil302893164 (SEQ ID NO: 91), Sordaria macrospore gil336266150 (SEQ ID NO: 92), Glomerella graminicola gil310797947 (SEQ ID NO: 93), Neurospora tetrasperma gil336469805 (SEQ ID NO: 94), Neurospora crassa gil85086707 (SEQ ID NO: 95), Magnaporthe oryzae gil145608997 (SEQ ID NO: 96), Chaetomium globosum gil116208730 (SEQ ID NO: 97), M. thermophila gi367029081 (SEQ ID NO: 539), and homologs thereof. [00138] Accordingly, in certain embodiments, a protease of the present disclosure, typically a sip] protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 82-97, SEQ ID NO:539. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 82-97, SEQ ID NO:539. [00139] In some embodiments, sip] is T. reesei sip]. The amino acid sequence encoded by T. reesei sip] is set forth in SEQ ID NO: 82. In other embodiments, a protease of the present 35 WO 2013/102674 PCT/EP2013/050126 disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 82. In further embodiments, the protease has 100% identity to SEQ ID NO: 82. Slp2 [00140] Examples of suitable sip2 proteases include, without limitation, Trichoderma reesei sip2 (SEQ ID NO: 98), T atroviride jgilTriat2 (SEQ ID NO: 99), Tvirens jgilTriviGv29_8_2 (SEQ ID NO: 100), Hypocrea lixii gil115111226 (SEQ ID NO: 101), Aspergillusfumigatus gi170997972 (SEQ ID NO: 102), Nectria haematococca gi1302915240 (SEQ ID NO: 103), Gibberella zeae gil46105128 (SEQ ID NO: 104), Isariafarinose gil68165000 (SEQ ID NO: 105), Glomerella graminicola gil310797854 (SEQ ID NO: 106), Epichloefestucae gi1170674491 (SEQ ID NO: 107), Metarhizium acridum gil322697754 (SEQ ID NO: 108), Acremonium sp. F11177 gi1147225254 (SEQ ID NO: 109), Ophiostomapihferum gi115808807 (SEQ ID NO: 110), Neurospora tetrasperma gil336463649 (SEQ ID NO: 111), Chaetomium thermophilum gi1340992600 (SEQ ID NO: 112), Metarhiziumflavoviride gil254351265 (SEQ ID NO: 113), Podospora anserine gil171680111 (SEQ ID NO: 114), Magnaporthe oryzae gil39943180 (SEQ ID NO: 115), Sclerotinia sclerotiorum gi1156058540 (SEQ ID NO: 116), Talaromyces stipitatus gil242790441 (SEQ ID NO: 117), M. thermophila gi367021472 (SEQ ID NO: 540), A. niger gil45237646 (SEQ ID NO: 541), A. oryzae gil69780712 (SEQ ID NO: 542), P. chrysogenum gi255955889 (SEQ ID NO: 543), A. nidulans gi259489544 (SEQ ID NO: 544), N. crassa gi85084841 (SEQ ID NO: 545), and homologs thereof. [00141] Accordingly, in certain embodiments, a protease of the present disclosure, typically a sip2 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 98-117, SEQ ID NOs:540-545. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 98-117, SEQ ID NOs:540-545. 36 WO 2013/102674 PCT/EP2013/050126 [00142] In some embodiments, slp2 is T. reesei slp2. The amino acid sequence encoded by T. reesei slp2 is set forth in SEQ ID NO: 98. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 98. In further embodiments, the protease has 100% identity to SEQ ID NO: 98. Slp3 [00143] Examples of suitable slp3 proteases include, without limitation, Trichoderma reesei slp2 (SEQ ID NO: 166), T. atroviride jgilTriat2 (SEQ ID NO: 167), T. virens jgilTriviGv29_8_2 (SEQ ID NO: 168), Hypocrea koningii gil124295071 (SEQ ID NO: 169), Purpureocillium lilacinum gil130750164 (SEQ ID NO: 170), Metarhizium anisopliae gil16215677 (SEQ ID NO: 171), Hirsutella rhossiliensis gil90655148 (SEQ ID NO: 172), Tolypocladium inflatum gil18542429 (SEQ ID NO: 173), Metacordyceps chlamydosporia gil19171215 (SEQ ID NO: 174), Cordyceps militaris gil346321368 (SEQ ID NO: 175), Fusarium sp. gil628051 (SEQ ID NO: 176), Neurospora tetrasperma gil336471881 (SEQ ID NO: 177), Chaetomium globosum gil116197403 (SEQ ID NO: 178), Neurospora crassa gil85084841 (SEQ ID NO: 179), Fusarium oxysporum gil56201265 (SEQ ID NO: 180), Gibberella zeae gil46114268 (SEQ ID NO: 181), M. thermophila gi367026259 (SEQ ID NO: 546), A. nidulans gi67538776 (SEQ ID NO: 547), A. oryzae gil69771349 (SEQ ID NO: 222), A. niger gi470729 (SEQ ID NO: 223), and homologs thereof. [00144] Accordingly, in certain embodiments, a protease of the present disclosure, typically a sip3 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 166-181, SEQ ID NOs:546-547, SEQ ID NOs:222-223. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 166-181, SEQ ID NOs:546-547, SEQ ID NOs:222-223. [00145] In some embodiments, sip3 is T. reesei sip3. The amino acid sequence encoded by T. reesei sip3 is set forth in SEQ ID NO: 166. In other embodiments, a protease of the present 37 WO 2013/102674 PCT/EP2013/050126 disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 166. In further embodiments, the protease has 100% identity to SEQ ID NO: 166. SIp5 [00146] Examples of suitable slp5 proteases include, without limitation, Trichoderma reesei slp5 (SEQ ID NO: 200), T. atroviride jgilTriat2 (SEQ ID NO: 201), T. virens jgilTriviGv29_8_2 (SEQ ID NO: 202), Hypocrea lixii gi1118161442 (SEQ ID NO: 203), Fusarium oxysporum gil342883549 (SEQ ID NO: 204), Gibberella zeae gil46135733 (SEQ ID NO: 205), Glomerella graminicola gi1310796396 (SEQ ID NO: 206), Nectria haematococca gi1302927954 (SEQ ID NO: 207), Cordyceps militaris gil346319783 (SEQ ID NO: 208), Neurospora crassa gil85094084 (SEQ ID NO: 209), Neurospora tetrasperma gil336467281 (SEQ ID NO: 210), Verticillium dahliae gil346971706 (SEQ ID NO: 211), Thielavia terrestris gil347001418 (SEQ ID NO: 212), Magnaporthe oryzae gi1145605493 (SEQ ID NO: 213), M. thermophila gi367032200 (SEQ ID NO: 548), P. chrysogenum gi62816282 (SEQ ID NO: 549), and homologs thereof. [00147] Accordingly, in certain embodiments, a protease of the present disclosure, typically a sip5 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 200-213, SEQ ID NOs:548-549. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 200-213, SEQ ID NOs:548-549. [00148] In some embodiments, sip5 is T. reesei sip5. The amino acid sequence encoded by T. reesei sip5 is set forth in SEQ ID NO: 200. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 200. In further embodiments, the protease has 100% identity to SEQ ID NO: 200. Sip6 38 WO 2013/102674 PCT/EP2013/050126 [00149] Examples of suitable slp6 proteases include, without limitation, Trichoderma reesei slp6 (SEQ ID NO: 214), T. atroviride jgilTriat2 (SEQ ID NO: 215), T. virens jgilTriviGv29_8_2 (SEQ ID NO: 216), Hypocrea virens gil29421423 (SEQ ID NO: 217), Hypocrea lixii gi1145583127 (SEQ ID NO: 218), Trichoderma hamatum gil30144643 (SEQ ID NO: 219), Aspergillusfumigatus gil2295 (SEQ ID NO: 220), Aspergillus terreus gil115391147 (SEQ ID NO: 221), Aspergillus oryzae gil169771349 (SEQ ID NO: 222), Aspergillus niger gil470729 (SEQ ID NO: 223), Glomerella graminicola gil310794714 (SEQ ID NO: 224), Gibberella zeae gil46114946 (SEQ ID NO: 225), Fusarium oxysporum gil342873942 (SEQ ID NO: 226), Nectria haematococca gil302884541 (SEQ ID NO: 227), Neosartorya fischeri gil119500190 (SEQ ID NO: 228), Verticillium alboatrum gil302413161 (SEQ ID NO: 229), Glomerella graminicola gil310790144 (SEQ ID NO: 230), N. crassa gi85090020 (SEQ ID NO: 550), and homologs thereof. [00150] Accordingly, in certain embodiments, a protease of the present disclosure, typically a sip6 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 214-230, SEQ ID NO:550. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 214-230, SEQ ID NO:550. [00151] In some embodiments, sip6 is T. reesei sip6. The amino acid sequence encoded by T. reesei sip6 is set forth in SEQ ID NO: 214. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 214. In further embodiments, the protease has 100% identity to SEQ ID NO: 214. Slp7 [00152] Examples of suitable sip7 proteases include, without limitation, Trichoderma reesei sip7 (SEQ ID NO: 231), T. atroviride jgilTriat2 (SEQ ID NO: 232), T. virens jgilTriviGv29_8_2 (SEQ ID NO: 233), Metarhizium anisopliae gil322710320 (SEQ ID NO: 234), Nectria 39 WO 2013/102674 PCT/EP2013/050126 haematococca gi1302915000 (SEQ ID NO: 235), Myceliophthora thermophila gil347009020, gi367024935 (SEQ ID NO: 236), Gibberella zeae gil46137655 (SEQ ID NO: 237), Thielavia terrestris gil346996549 (SEQ ID NO: 238), Magnaporthe oryzae gi1145610733 (SEQ ID NO: 239), A. nidulans gi67541991 (SEQ ID NO: 551), P. chrysogenum gi255933786 (SEQ ID NO: 552), A. niger gi317036543 (SEQ ID NO: 553), A. oryzae gil69782882 (SEQ ID NO: 554), N. crassa gi85109979 (SEQ ID NO: 555), and homologs thereof. [00153] Accordingly, in certain embodiments, a protease of the present disclosure, typically a sip7 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 231-239, SEQ ID NOs:551-555. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 231-239, SEQ ID NOs:551-555. [00154] In some embodiments, sip7 is T. reesei sip7. The amino acid sequence encoded by T. reesei sip7 is set forth in SEQ ID NO: 231. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 231. In further embodiments, the protease has 100% identity to SEQ ID NO: 231. Sip8 [00155] Examples of suitable sip8 proteases include, without limitation, Trichoderma reesei sip8 (SEQ ID NO: 240), T. atroviride jgilTriat21198568 (SEQ ID NO: 241), T. virens jgilTriviGv29_8_2133902 (SEQ ID NO: 242), and homologs thereof. [00156] Accordingly, in certain embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 240-242. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 240-242. 40 WO 2013/102674 PCT/EP2013/050126 [00157] In some embodiments, slp8 is T. reesei slp8. The amino acid sequence encoded by T. reesei slp8 is set forth in SEQ ID NO: 240. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 240. In further embodiments, the protease has 100% identity to SEQ ID NO: 240. Glutamic Proteases [00158] Glutamic proteases are enzymes that hydrolyze the peptide bonds in polypeptides and proteins. Glutamic proteases are insensitive to pepstatin A, and so are sometimes referred to as pepstatin insensitive acid proteases. While glutamic proteases were previously grouped with the aspartic proteases and often jointly referred to as acid proteases, it has been recently found that glutamic proteases have very different active site residues than aspartic proteases. [00159] Two glutamic proteases have been identified in Trichoderma fungal cells: gap] (tre69555) and gap2 (tre106661). Gap] [00160] Examples of suitable gap] proteases include, without limitation, Trichoderma reesei gap] (SEQ ID NO: 118), T. atroviride jgilTriat240863 (SEQ ID NO: 119), T. virens jgilTriviGv29_8_21192684 (SEQ ID NO: 120), Aspergillusflavus gil238499183 (SEQ ID NO: 121), Aspergillus niger gil145251555 (SEQ ID NO: 122), Aspergillus terreus gil115491521 (SEQ ID NO: 123), gil37154543 (SEQ ID NO: 124), gil48425531 (SEQ ID NO: 125), gil351873 (SEQ ID NO: 126), Thielavia terrestris gil346997245 (SEQ ID NO: 127), Penicillium chrysogenum gil255940586 (SEQ ID NO: 128), M. thermophila gi367026504 (SEQ ID NO: 574), A. oryzae gi317150886 (SEQ ID NO: 575), N. crassa gi85097968 (SEQ ID NO: 576), A. niger gil31056 (SEQ ID NO: 577), P. chrysogenum gi255930123 (SEQ ID NO: 578), A. niger gi145236956 (SEQ ID NO: 579), A. oryzae gi169772955 (SEQ ID NO: 580), A. niger gi145249222 (SEQ ID NO: 581), A. nidulans gi67525839 (SEQ ID NO: 582), A. oryzae gil69785367 (SEQ ID NO: 583), P. chrysogenum gi255955319 (SEQ ID NO: 584), M. thermophila gi367019352 (SEQ ID 41 WO 2013/102674 PCT/EP2013/050126 NO: 585), A oryzae gi391863974 (SEQ ID NO: 586), M. thermophila gi367024513 (SEQ ID NO: 587), and homologs thereof. [00161] Accordingly, in certain embodiments, a protease of the present disclosure, typically a gap] protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 118-128, SEQ ID NOs:574-587. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 118-128, SEQ ID NOs:574-587. [00162] In some embodiments, gap] is T. reesei gap]. The amino acid sequence encoded by T. reesei gap] is set forth in SEQ ID NO: 118. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 118. In further embodiments, the protease has 100% identity to SEQ ID NO: 118. Gap2 [00163] Examples of suitable gap2 proteases include, without limitation, Trichoderma reesei gap2 (SEQ ID NO: 129), T. atroviride jgilTriat2|298116 (SEQ ID NO: 130), T. virens jgilTriviGv29_8_2130331 (SEQ ID NO: 131), jgilTriviGv29_8_21225131 (SEQ ID NO: 132), Aspergillusflavus gil238499183 (SEQ ID NO: 133), Aspergillus niger gil145251555 (SEQ ID NO: 134), Aspergillus nidulans gil67901056 (SEQ ID NO: 135), Aspergillus clavatus gil121711990 (SEQ ID NO: 136), Aspergillusfumigatus gil70986250 (SEQ ID NO: 137), Penicillium marneffei gil212534108 (SEQ ID NO: 138), Talaromyces stipitatus gil242789335 (SEQ ID NO: 139), Grosmannia clavigera gil320591529 (SEQ ID NO: 140), Neosartorya fischeri gil119474281 (SEQ ID NO: 141), Penicillium marneffei gil212527274 (SEQ ID NO: 142), Penicillium chrysogenum gil255940586 (SEQ ID NO: 143), gil131056 (SEQ ID NO: 144), M. thermophila gi367030275 (SEQ ID NO: 588), and homologs thereof. [00164] Accordingly, in certain embodiments, a protease of the present disclosure, typically a gap2 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 42 WO 2013/102674 PCT/EP2013/050126 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 129-144, SEQ ID NO:588. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 129-144, SEQ ID NO:588. [00165] In some embodiments, gap2 is T. reesei gap2. The amino acid sequence encoded by T. reesei gap2 is set forth in SEQ ID NO: 129. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 129. In further embodiments, the protease has 100% identity to SEQ ID NO: 129. Sedolisin Proteases [00166] Sedolisin proteases are enzymes that use a serine residue for hydrolysis of the peptide bonds in polypeptides and proteins. Sedolisin proteases generally contain a unique catalytic triad of serine, glutamate, and aspartate. Sedolisin proteases also contain an aspartate residue in the oxyanion hole. Sedolisin proteases from eukaryotic organisms such as Trichoderma fungi include tripeptidyl peptidase. [00167] Examples of suitable tpp1 proteases include, without limitation, Trichoderma reesei tpp1 (SEQ ID NO: 145), T. atroviridejgilTriat21188756 (SEQ ID NO: 146), T. virens jgilTriviGv29_8_21217176 (SEQ ID NO: 147), Aspergillusfumigatus gil70993168 (SEQ ID NO: 148), Aspergillus oryzae gi1169776800 (SEQ ID NO: 149), Aspergillus niger gil145236399 (SEQ ID NO: 150), Aspergillus clavatus gil121708799 (SEQ ID NO: 151), Aspergillus niger gi1145239871 (SEQ ID NO: 152), Aspergillus clavatus gil121714541 (SEQ ID NO: 153), Aspergillus terreus gil115387645 (SEQ ID NO: 154), Aspergillus fumigatus gil70982015 (SEQ ID NO: 155), Sclerotinia sclerotiorum gi1156045898 (SEQ ID NO: 156), Botryotiniafuckeliana gi1154321758 (SEQ ID NO: 157), Neosartoryafischeri gil119499774 (SEQ ID NO: 158), Talaromyces stipitatus gil242798348 (SEQ ID NO: 159), Penicillium marneffei gil212541546 (SEQ ID NO: 160), Gibberella zeae gil46114460 (SEQ ID NO: 161), Fusarium oxysporum gil342890694 (SEQ ID NO: 162), Grosmannia clavigera gil320592937 (SEQ ID NO: 163), 43 WO 2013/102674 PCT/EP2013/050126 Verticillium alboatrum gi1302406186 (SEQ ID NO: 164), Verticillium dahliae gil346971444 (SEQ ID NO: 165), A. fumigatus CAE51075.1 (SEQ ID NO: 556), A. oryzae XP_001820835.1 (SEQ ID NO: 557), P. chrysogenum XP_002564029.1 (SEQ ID NO: 558), A. nidulans XP_664805.1 (SEQ ID NO: 559), P. chrysogenum XP_002565814.1 (SEQ ID NO: 560), M. thermophila XP_003663689.1 (SEQ ID NO: 561), N. crassa XP_958412.1 (SEQ ID NO: 562), A. niger XP_001394118.1 (SEQ ID NO: 563), A. fumigatus CAE17674.1 (SEQ ID NO: 564), A. niger XP_001400873.1 (SEQ ID NO: 565), A. fumigatus CAE46473.1 (SEQ ID NO: 566), A. oryzae XP_002373530.1 (SEQ ID NO: 567), A. nidulans XP_660624.1 (SEQ ID NO: 568), P. chrysogenum XP_002562943.1 (SEQ ID NO: 569), A. fumigatus CAE17675.1 (SEQ ID NO: 570), A. fumigatus EAL86850.2 (SEQ ID NO: 571), N. crassa XP_961957.1 (SEQ ID NO: 572), A. oryzae BAB97387.1 (SEQ ID NO: 573), and homologs thereof. [00168] Accordingly, in certain embodiments, a protease of the present disclosure, typically a tpp1 protease, has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more to an amino acid sequence selected from SEQ ID NOs: 145-165, SEQ ID NOs:556-573. In some embodiments, the protease has 100% identity to an amino acid sequence selected from SEQ ID NOs: 145-165, SEQ ID NOs:556-573. [00169] In some embodiments, tpp1 is T. reesei tppl. The amino acid sequence encoded by T. reesei tpp1 is set forth in SEQ ID NO: 145. In other embodiments, a protease of the present disclosure has an amino acid sequence having 50% or more identity (e.g. 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more) to SEQ ID NO: 145. In further embodiments, the protease has 100% identity to SEQ ID NO: 145. Homologous Proteases [00170] Other embodiments of the present disclosure relate to reducing the activity of proteases that are homologous to the proteases of the present disclosure. "Homology" as used herein refers to sequence similarity between a reference sequence and at least a fragment of a second sequence. Homologs may be identified by any method known in the art, preferably, by 44 WO 2013/102674 PCT/EP2013/050126 using the BLAST tool to compare a reference sequence to a single second sequence or fragment of a sequence or to a database of sequences. As described below, BLAST will compare sequences based upon percent identity and similarity. [00171] The terms "identical" or percent "identity," in the context of two or more nucleic acid or amino acid sequences, refers to two or more sequences or subsequences that are the same. Two sequences are "substantially identical" if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 29% identity, optionally 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200, or more amino acids) in length. [00172] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. When comparing two sequences for identity, it is not necessary that the sequences be contiguous, but any gap would carry with it a penalty that would reduce the overall percent identity. For blastn, the default parameters are Gap opening penalty=5 and Gap extension penalty=2. For blastp, the default parameters are Gap opening penalty= 11 and Gap extension penalty= 1. [00173] A "comparison window," as used herein, includes reference to a segment of any one of the number of contiguous positions including, but not limited to from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a 45 WO 2013/102674 PCT/EP2013/050126 reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1981), by the homology alignment algorithm of Needleman and Wunsch (1970) J Mol Biol 48(3):443-453, by the search for similarity method of Pearson and Lipman (1988) Proc Natl Acad Sci USA 85(8):2444-2448, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection [see, e.g., Brent et al., (2003) Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (Ringbou Ed)]. [00174] Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1997) Nucleic Acids Res 25(17):3389-3402 and Altschul et al. (1990) J. Mol Biol 215(3)-403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for 46 WO 2013/102674 PCT/EP2013/050126 nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=-4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix [see Henikoff and Henikoff, (1992) Proc Natl Acad Sci USA 89(22):10915-10919] alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands. [00175] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, (1993) Proc Natl Acad Sci USA 90(12):5873 5877). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001. [00176] Other than percentage of sequence identity noted above, another indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross-reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below. Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence. [00177] As disclosed herein, proteases of the present disclosure may also include proteases that are conservatively modified variants of proteases encoded by the protease genes disclosed above. "Conservatively modified variants" as used herein include individual substitutions, deletions or additions to an encoded amino acid sequence which result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing 47 WO 2013/102674 PCT/EP2013/050126 functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the disclosure. The following eight groups contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)). [00178] Figures 45-48 depicts phylogenetic trees of aspartic, subtilisin, glutamic and sedolisin proteases of selected filamentous fungi. Methods of Reducing the Activity of Proteases of the Invention [00179] Further aspects of the present disclosure relate to reducing the activity of proteases found in filamentous fungal cells that express a heterologous polypeptide, such a mammalian polypeptide. [00180] The activity of proteases found in filamentous fungal cells can be reduced by any method known to those of skill in the art. [00181] In some embodiments reduced activity of proteases is achieved by reducing the expression of the protease, for example, by promoter modification or RNAi. [00182] In other embodiments, reduced activity of proteases is achieved by modifying the gene encoding the protease. Examples of such modifications include, without limitation, a knock-out mutation, a truncation mutation, a point mutation, a missense mutation, a substitution mutation, a frameshift mutation, an insertion mutation, a duplication mutation, an amplification mutation, a translocation mutation, or an inversion mutation, and that results in a reduction in the corresponding protease activity. Methods of generating at least one mutation in a protease encoding gene of interest are well known in the art and include, without limitation, random mutagenesis and screening, site-directed mutagenesis, PCR mutagenesis, insertional mutagenesis, chemical mutagenesis, and irradiation. 48 WO 2013/102674 PCT/EP2013/050126 [00183] In certain embodiments, a portion of the protease encoding gene is modified, such as the region encoding the catalytic domain, the coding region, or a control sequence required for expression of the coding region. Such a control sequence of the gene may be a promoter sequence or a functional part thereof, i.e., a part that is sufficient for affecting expression of the gene. For example, a promoter sequence may be inactivated resulting in no expression or a weaker promoter may be substituted for the native promoter sequence to reduce expression of the coding sequence. Other control sequences for possible modification include, without limitation, a leader sequence, a propeptide sequence, a signal sequence, a transcription terminator, and a transcriptional activator. [00184] Protease encoding genes of the present disclosure that are present in filamentous fungal cells that express a recombinant polypeptide may also be modified by utilizing gene deletion techniques to eliminate or reduce expression of the gene. Gene deletion techniques enable the partial or complete removal of the gene thereby eliminating their expression. In such methods, deletion of the gene may be accomplished by homologous recombination using a plasmid that has been constructed to contiguously contain the 5' and 3' regions flanking the gene. [00185] The protease encoding genes of the present disclosure that are present in filamentous fungal cells that express a recombinant polypeptide may also be modified by introducing, substituting, and/or removing one or more nucleotides in the gene, or a control sequence thereof required for the transcription or translation of the gene. For example, nucleotides may be inserted or removed for the introduction of a stop codon, the removal of the start codon, or a frame-shift of the open reading frame. Such a modification may be accomplished by methods known in the art, including without limitation, site-directed mutagenesis and peR generated mutagenesis (see, for example, Botstein and Shortie, 1985, Science 229: 4719; Lo et al., 1985, Proceedings of the National Academy of Sciences USA 81: 2285; Higuchi et al., 1988, Nucleic Acids Research 16: 7351; Shimada, 1996, Meth. Mol. Bioi. 57: 157; Ho et al., 1989, Gene 77: 61; Horton et al., 1989, Gene 77: 61; and Sarkar and Sommer, 1990, BioTechniques 8: 404). [00186] Additionally, protease encoding genes of the present disclosure that are present in filamentous fungal cells that express a recombinant polypeptide may be modified by gene 49 WO 2013/102674 PCT/EP2013/050126 disruption techniques by inserting into the gene a disruptive nucleic acid construct containing a nucleic acid fragment homologous to the gene that will create a duplication of the region of homology and incorporate construct DNA between the duplicated regions. Such a gene disruption can eliminate gene expression if the inserted construct separates the promoter of the gene from the coding region or interrupts the coding sequence such that a nonfunctional gene product results. A disrupting construct may be simply a selectable marker gene accompanied by 5' and 3' regions homologous to the gene. The selectable marker enables identification of transformants containing the disrupted gene. [00187] Protease encoding genes of the present disclosure that are present in filamentous fungal cells that express a recombinant polypeptide may also be modified by the process of gene conversion (see, for example, Iglesias and Trautner, 1983, Molecular General Genetics 189:5 73 76). For example, in the gene conversion a nucleotide sequence corresponding to the gene is mutagenized in vitro to produce a defective nucleotide sequence, which is then transformed into a Trichoderma strain to produce a defective gene. By homologous recombination, the defective nucleotide sequence replaces the endogenous gene. It may be desirable that the defective nucleotide sequence also contains a marker for selection of transformants containing the defective gene. [00188] Protease encoding genes of the present disclosure that are present in filamentous fungal cells that express a recombinant polypeptide may also be modified by established anti sense techniques using a nucleotide sequence complementary to the nucleotide sequence of the gene (see, for example, Parish and Stoker, 1997, FEMS Microbiology Letters 154: 151-157). In particular, expression of the gene by filamentous fungal cells may be reduced or inactivated by introducing a nucleotide sequence complementary to the nucleotide sequence of the gene, which may be transcribed in the strain and is capable of hybridizing to the mRNA produced in the cells. Under conditions allowing the complementary anti-sense nucleotide sequence to hybridize to the mRNA, the amount of protein translated is thus reduced or eliminated. [00189] In addition, protease encoding genes of the present disclosure that are present in filamentous fungal cells that express a recombinant polypeptide may also be modified by 50 WO 2013/102674 PCT/EP2013/050126 established RNA interference (RNAi) techniques (see, for example, WO 2005/056772 and WO 2008/080017). [00190] Protease encoding genes of the present disclosure that are present in filamentous fungal cells that express a recombinant polypeptide may also be modified by random or specific mutagenesis using methods well known in the art, including without limitation, chemical mutagenesis (see, for example, Hopwood, The Isolation of Mutants in Methods in Microbiology (J.R. Norris and D.W. Ribbons, eds.) pp. 363-433, Academic Press, New York, 25 1970). Modification of the gene may be performed by subjecting filamentous fungal cells to mutagenesis and screening for mutant cells in which expression of the gene has been reduced or inactivated. The mutagenesis, which may be specific or random, may be performed, for example, by use of a suitable physical or chemical mutagenizing agent, use of a suitable oligonucleotide, subjecting the DNA sequence to peR generated mutagenesis, or any combination thereof. Examples of physical and chemical mutagenizing agents include, without limitation, ultraviolet (UV) irradiation, hydroxylamine, N-methyl-N'-nitro-N-nitrosoguanidine (MNNG), N-methyl-N' nitrosogaunidine (NTG) 0-methyl hydroxylamine, nitrous acid, ethyl methane sulphonate (EMS), sodium bisulphite, formic acid, and nucleotide analogues. When such agents are used, the mutagenesis is typically performed by incubating the Trichoderma cells to be mutagenized in the presence of the mutagenizing agent of choice under suitable conditions, and then selecting for mutants exhibiting reduced or no expression of the gene. [00191] In certain embodiments, the at least one mutation or modification in a protease encoding gene of the present disclosure results in a modified protease that has no detectable protease activity. In other embodiments, the at least one modification in a protease encoding gene of the present disclosure results in a modified protease that has at least 25% less, at least 50% less, at least 75% less, at least 90%, at least 95%, at least 100%, at least 200%, at least 300%, at least 400%, at least 500%, at least 600%, at least 700%, at least 800%, at least 900%, at least 1,000%, or a higher percentage less protease activity compared to a corresponding non modified protease. 51 WO 2013/102674 PCT/EP2013/050126 [00192] In certain embodiments, for example, in a Trichoderma cell, the at least one mutation or modification in a protease encoding gene of the present disclosure results in a reduction of total protease activity to 49% or less, typically with a mutation in at least 2 distinct protease genes, or 31% or less, typically with a mutation in at least 3 distinct protease genes, or 13% or less, typically with a mutation in at least 4 distinct protease genes, or 10% or less, typically with a mutation in at least 5 distinct protease genes, or 6.3% or less, typically with a mutation in at least 6 distinct protease genes, or 5.5% or less, typically with a mutation in at least 7 distinct protease genes, of the total protease activity of the corresponding parental Trichoderma cell. Heterologous Polypeptides of the Invention [00193] The invention herein further relates to increasing the production of heterologous polypeptides in filamentous fungal cells that express such heterologous polypeptides by reducing the activity of proteases found in the cells. [00194] As used herein a "heterologous polypeptide" refers to a polypeptide that is not naturally found in (i.e., endogenous) a filamentous fungal cell of the present disclosure, or that is expressed at an elevated level in a filamentous fungal cell as compared to the endogenous version of the polypeptide. In certain embodiments, the heterologous polypeptide is a mammalian polypeptide. In other embodiments, the heterologous polypeptide is a non-mammalian polypeptide. Mammalian Polypeptides [00195] Mammalian polypeptides of the present disclosure may be any mammalian polypeptide having a biological activity of interest. As used herein, a "mammalian polypeptide" is a polypeptide that is natively expressed in a mammal, a polypeptide that is derived from a polypeptide that is natively expressed in a mammal, or a fragment thereof. A mammalian polypeptide also includes peptides and oligopeptides that retain biological activity. Mammalian polypeptides of the present disclosure may also include two or more polypeptides that are combined to form the encoded product. Mammalian polypeptides of the present disclosure may further include fusion polypeptides, which contain a combination of partial or complete amino 52 WO 2013/102674 PCT/EP2013/050126 acid sequences obtained from at least two different polypeptides. Mammalian polypeptides may also include naturally occurring allelic and engineered variations of any of the disclosed mammalian polypeptides and hybrid mammalian polypeptides. [00196] The mammalian polypeptide may be a naturally glycosylated polypeptide or a naturally non-glycosylated polypeptide. [00197] Examples of suitable mammalian polypeptides include, without limitation, immunoglobulins, antibodies, antigens, antimicrobial peptides, enzymes, growth factors, hormones, interferons, cytokines, interleukins, immunodilators, neurotransmitters, receptors, reporter proteins, structural proteins, and transcription factors. [00198] Specific examples of suitable mammalian polypeptides include, without limitation, immunoglobulins, immunoglobulin heavy chains, immunoglobulin light chains, monoclonal antibodies, hybrid antibodies, F(ab')2 antibody fragments, F(ab) antibody fragments, Fv molecules, single-chain Fv antibodies, dimeric antibody fragments, trimeric antibody fragments, functional antibody fragments, immunoadhesins, insulin-like growth factor 1, growth hormone, insulin, interferon alpha 2b, fibroblast growth factor 21, human serum albumin, camelid antibodies and/or antibody fragments, single domain antibodies, multimeric single domain antibodies, and erythropoietin. [00199] Other examples of suitable mammalian proteins include, without limitation, an oxidoreductase, a transferase, a hydrolase, a lyase, an isomerase, a ligase, an aminopeptidase, an amylase, a carbohydrase, a carboxypeptidase, a catalase, a glycosyltransferase, a deoxyribonuclease, an esterase, a galactosidase, a betagalactosidase, a glucosidase, a glucuronidase, a glucuronoyl esterase, a haloperoxidase, an invertase, a lipase, an oxidase, a phospholipase, a proteolytic enzyme, a ribonuclease, a urokinase, an albumin, a collagen, a tropoelastin, and an elastin. Non-mammalian Polypeptides 53 WO 2013/102674 PCT/EP2013/050126 [00200] Non-mammalian polypeptides of the present disclosure may be any non-mammalian polypeptide having a biological activity of interest. As used herein, a "non-mammalian polypeptide" is a polypeptide that is natively expressed in a non-mammalian organism, such as a fungal cell, a polypeptide that is derived from a polypeptide that is natively expressed in a non mammal organism, or a fragment thereof. A non-mammalian polypeptide also includes peptides and oligopeptides that retain biological activity. Non-mammalian polypeptides of the present disclosure may also include two or more polypeptides that are combined to form the encoded product. Non-mammalian polypeptides of the present disclosure may further include fusion polypeptides, which contain a combination of partial or complete amino acid sequences obtained from at least two different polypeptides. Non-mammalian polypeptides may also include naturally occurring allelic and engineered variations of any of the disclosed non-mammalian polypeptides and hybrid non-mammalian polypeptides. [00201] Examples of suitable non-mammalian polypeptides include, without limitation, aminopeptidases, amylases, carbohydrases, carboxypeptidases, catalases, cellulases, chitinases, cutinases, deoxyribonucleases, esterases, alpha-galactosidases, beta-galactosidases, glucoamylases, alpha-glucosidases, beta-glucosidases, invertases, laccases, lipases, mutanases, oxidases, pectinolytic enzymes, peroxidases, phospholipases, phytases, polyphenoloxidases, proteolytic enzymes, ribonucleases, transglutaminases and xylanases. Heterologous Polypeptide Production [00202] A heterologous polypeptide of interest is produced by filamentous fungal cells of the present disclosure containing at least three proteases having reduced activity by cultivating the cells in a nutrient medium for production of the heterologous polypeptide using methods known in the art. For example, the cells may be cultivated by shake flask cultivation, small-scale or large-scale fermentation (including continuous, batch, fed-batch, or solid state fermentations) in laboratory or industrial fermentors performed in a suitable medium and under conditions allowing the polypeptide to be expressed and/or isolated. The cultivation takes place in a suitable nutrient medium comprising carbon and nitrogen sources and inorganic salts, using procedures known in the art. Suitable media are available from commercial suppliers or may be prepared 54 WO 2013/102674 PCT/EP2013/050126 according to published compositions (e.g., in catalogues of the American Type Culture Collection). The secreted polypeptide can be recovered directly from the medium. If the polypeptide is not secreted, it may be obtained from cell lysates. [00203] A heterologous polypeptide of interest produced by a filamentous fungal cell of the present disclosure containing at least three proteases having reduced activity may be detected using methods known in the art that are specific for the heterologous polypeptide. These detection methods may include, without limitation, use of specific antibodies, high performance liquid chromatography, capillary chromatography, formation of an enzyme product, disappearance of an enzyme substrate, and SDS-PAGE. For example, an enzyme assay may be used to determine the activity of an enzyme. Procedures for determining enzyme activity are known in the art for many enzymes (see, for example, 0. Schomburg and M. Salzmann (eds.), Enzyme Handbook, Springer-Verlag, New York, 1990). [00204] The resulting heterologous polypeptide may be isolated by methods known in the art. For example, a heterologous polypeptide of interest may be isolated from the cultivation medium by conventional procedures including, without limitation, centrifugation, filtration, extraction, spray-drying, evaporation, and precipitation. The isolated heterologous polypeptide may then be further purified by a variety of procedures known in the art including, without limitation, chromatography (e.g., ion exchange, affinity, hydrophobic, chromatofocusing, and size exclusion), electrophoretic procedures (e.g., preparative isoelectric focusing (IEF), differential solubility (e.g., ammonium sulfate precipitation), or extraction (see, for example, Protein Purification, J.-C. Janson and Lars Ryden, editors, VCH Publishers, New York, 1989). Preparation of Polynucleotides Encoding Heterologous Polypeptides [00205] Sequences of the heterologous polynucleotides of the present disclosure are prepared by any suitable method known in the art, including, without limitation, direct chemical synthesis or cloning. For direct chemical synthesis, formation of a polymer of nucleic acids typically involves sequential addition of 3 '-blocked and 5 '-blocked nucleotide monomers to the terminal 5-hydroxyl group of a growing nucleotide chain, wherein each addition is effected by 55 WO 2013/102674 PCT/EP2013/050126 nucleophilic attack of the terminal 5'-hydroxyl group of the growing chain on the 3 '-position of the added monomer, which is typically a phosphorus derivative, such as a phosphotriester, phosphoramidite, or the like. Such methodology is known to those of ordinary skill in the art and is described in the pertinent texts and literature [e.g., in Matteucci et al., (1980) Tetrahedron Lett 21:719-722; U.S. Pat. Nos. 4,500,707; 5,436,327; and 5,700,637]. In addition, the desired sequences may be isolated from natural sources by splitting DNA using appropriate restriction enzymes, separating the fragments using gel electrophoresis, and thereafter, recovering the desired nucleic acid sequence from the gel via techniques known to those of ordinary skill in the art, such as utilization of polymerase chain reactions (PCR; e.g., U.S. Pat. No. 4,683,195). [00206] Each heterologous polynucleotide of the present disclosure can be incorporated into an expression vector. "Expression vector" or "vector" refers to a compound and/or composition that transduces, transforms, or infects a host cell, thereby causing the cell to express nucleic acids and/or proteins other than those native to the cell, or in a manner not native to the cell. An "expression vector" contains a sequence of nucleic acids (ordinarily RNA or DNA) to be expressed by the host cell. Optionally, the expression vector also includes materials to aid in achieving entry of the nucleic acid into the host cell, such as a virus, liposome, protein coating, or the like. The expression vectors contemplated for use in the present disclosure include those into which a nucleic acid sequence can be inserted, along with any preferred or required operational elements. Further, the expression vector must be one that can be transferred into a host cell and replicated therein. Preferred expression vectors are plasmids, particularly those with restriction sites that have been well documented and that contain the operational elements preferred or required for transcription of the nucleic acid sequence. Such plasmids, as well as other expression vectors, are well known in the art. [00207] Incorporation of the individual polynucleotides may be accomplished through known methods that include, for example, the use of restriction enzymes (such as BamHI, EcoRI, HhaI, XhoI, XmaI, and so forth) to cleave specific sites in the expression vector, e.g., plasmid. The restriction enzyme produces single stranded ends that may be annealed to a polynucleotide having, or synthesized to have, a terminus with a sequence complementary to the ends of the cleaved expression vector. Annealing is performed using an appropriate enzyme, e.g., DNA 56 WO 2013/102674 PCT/EP2013/050126 ligase. As will be appreciated by those of ordinary skill in the art, both the expression vector and the desired polynucleotide are often cleaved with the same restriction enzyme, thereby assuring that the ends of the expression vector and the ends of the polynucleotide are complementary to each other. In addition, DNA linkers maybe used to facilitate linking of nucleic acids sequences into an expression vector. [00208] A series of individual polynucleotides can also be combined by utilizing methods that are known t in the art (e.g., U.S. Pat. No. 4,683,195). [00209] For example, each of the desired polynucleotides can be initially generated in a separate PCR. Thereafter, specific primers are designed such that the ends of the PCR products contain complementary sequences. When the PCR products are mixed, denatured, and reannealed, the strands having the matching sequences at their 3' ends overlap and can act as primers for each other. Extension of this overlap by DNA polymerase produces a molecule in which the original sequences are "spliced" together. In this way, a series of individual polynucleotides may be "spliced" together and subsequently transduced into a host cell simultaneously. Thus, expression of each of the plurality of polynucleotides is affected. [00210] Individual polynucleotides, or "spliced" polynucleotides, are then incorporated into an expression vector. The present disclosure is not limited with respect to the process by which the polynucleotide is incorporated into the expression vector. Those of ordinary skill in the art are familiar with the necessary steps for incorporating a polynucleotide into an expression vector. A typical expression vector contains the desired polynucleotide preceded by one or more regulatory regions, along with a ribosome binding site, e.g., a nucleotide sequence that is 3-9 nucleotides in length and located 3-11 nucleotides upstream of the initiation codon in E. coli. See Shine and Dalgarno (1975) Nature 254(5495):34-38 and Steitz (1979) Biological Regulation and Development (ed. Goldberger, R. F.), 1:349-399 (Plenum, New York). [00211] The term "operably linked" as used herein refers to a configuration in which a control sequence is placed at an appropriate position relative to the coding sequence of the DNA sequence or polynucleotide such that the control sequence directs the expression of a polypeptide. 57 WO 2013/102674 PCT/EP2013/050126 [00212] Regulatory regions include, for example, those regions that contain a promoter and an operator. A promoter is operably linked to the desired polynucleotide, thereby initiating transcription of the polynucleotide via an RNA polymerase enzyme. An operator is a sequence of nucleic acids adjacent to the promoter, which contains a protein-binding domain where a repressor protein can bind. In the absence of a repressor protein, transcription initiates through the promoter. When present, the repressor protein specific to the protein-binding domain of the operator binds to the operator, thereby inhibiting transcription. In this way, control of transcription is accomplished, based upon the particular regulatory regions used and the presence or absence of the corresponding repressor protein. Examples include lactose promoters (Lad repressor protein changes conformation when contacted with lactose, thereby preventing the Lad repressor protein from binding to the operator) and tryptophan promoters (when complexed with tryptophan, TrpR repressor protein has a conformation that binds the operator; in the absence of tryptophan, the TrpR repressor protein has a conformation that does not bind to the operator). Another example is the tac promoter (see de Boer et al., (1983) Proc Natl Acad Sci USA 80(1):21-25). As will be appreciated by those of ordinary skill in the art, these and other expression vectors may be used in the present disclosure, and the present disclosure is not limited in this respect. [00213] Although any suitable expression vector may be used to incorporate the desired sequences, readily available expression vectors include, without limitation: plasmids, such as pSClOl, pBR322, pBBRlMCS-3, pUR, pEX, pMR100, pCR4, pBAD24, pUC19, pRS426; and bacteriophages, such as Ml 3 phage and k phage. Of course, such expression vectors may only be suitable for particular host cells. One of ordinary skill in the art, however, can readily determine through routine experimentation whether any particular expression vector is suited for any given host cell. For example, the expression vector can be introduced into the host cell, which is then monitored for viability and expression of the sequences contained in the vector. In addition, reference may be made to the relevant texts and literature, which describe expression vectors and their suitability to any particular host cell. [00214] Suitable expression vectors for the purposes of the invention, including the expression of the desired heterologous polypeptide, enzyme, and one or more catalytic domains described 58 WO 2013/102674 PCT/EP2013/050126 herein, include expression vectors containing the polynucleotide encoding the desired heterologous polypeptide, enzyme, or catalytic domain(s) operably linked to a constitutive or an inducible promoter. Examples of particularly suitable promoters for operable linkage to such polynucleotides include promoters from the following genes: gpdA, cbhl, Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral alpha-amylase, Aspergillus niger acid stable alpha-amylase, Aspergillus niger glucoamylase (glaA), Aspergillus awamori glaA, Rhizomucor miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus oryzae triose phosphate isomerase, Aspergillus nidulans acetamidase, Aspergillus oryzae acetamidase, Fusarium oxysporum trypsin-like protease, fungal endo a-L-arabinase (abnA), fungal a-L-arabinofuranosidase A (abfA), fungal a-L-arabinofuranosidase B (abfB), fungal xylanase (xlnA), fungal phytase, fungal ATP-synthetase, fungal subunit 9 (oliC), fungal triose phosphate isomerase (tpi), fungal alcohol dehydrogenase (adhA), fungal a-amylase (amy), fungal amyloglucosidase (glaA), fungal acetamidase (amdS), fungal glyceraldehyde-3-phosphate dehydrogenase (gpd), yeast alcohol dehydrogenase, yeast lactase, yeast 3-phosphoglycerate kinase, yeast triosephosphate isomerase, bacterial a-amylase, bacterial Spo2, and SSO. Examples of such suitable expression vectors and promoters are also described in PCT/EP2011/070956, the entire contents of which is hereby incorporated by reference herein. Pharmaceutical Compositions Containing Heterologous Polypeptides Produced by Filamentous Fungal Cells of the Invention [00215] In another aspect, the present invention provides a composition, e.g., a pharmaceutical composition, containing one or more heterologous polypeptides of interest, such as mammalian polypeptides, produced by the filamentous fungal cells of the present disclosure having reduced activity of at least three proteases and further containing a recombinant polynucleotide encoding the heterologous polypeptide, formulated together with a pharmaceutically acceptable carrier. Pharmaceutical compositions of the invention also can be administered in combination therapy, i.e., combined with other agents. For example, the combination therapy can include a mammalian polypeptide of interest combined with at least one other therapeutic agent. 59 WO 2013/102674 PCT/EP2013/050126 [00216] As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the active compound, i.e., the mammalian polypeptide of interest, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound. [00217] The pharmaceutical compositions of the invention may include one or more pharmaceutically acceptable salts. A "pharmaceutically acceptable salt" refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al. (1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N' dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like. [00218] A pharmaceutical composition of the invention also may also include a pharmaceutically acceptable antioxidant. Examples of pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like. 60 WO 2013/102674 PCT/EP2013/050126 [00219] Examples of suitable aqueous and nonaqueous carriers that may be employed in the pharmaceutical compositions of the invention include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. [00220] These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin. [00221] Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the invention is contemplated. Supplementary active compounds can also be incorporated into the compositions. [00222] Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents, for example, sugars, 61 WO 2013/102674 PCT/EP2013/050126 polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin. [00223] Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the certain methods of preparation are vacuum drying and freeze-drying lyophilizationn) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. [00224] The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.01 percent to about ninety-nine percent of active ingredient, preferably from about 0.1 percent to about 70 percent, most preferably from about 1 percent to about 30 percent of active ingredient in combination with a pharmaceutically acceptable carrier. [00225] Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required 62 WO 2013/102674 PCT/EP2013/050126 pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals. [00226] For administration of a mammalian polypeptide of interest, in particular where the mammalian polypeptide is an antibody, the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight. For example, dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg. An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months. Certain dosage regimens for an antibody may include 1 mg/kg body weight or 3 mg/kg body weight via intravenous administration, with the antibody being given using one of the following dosing schedules: (i) every four weeks for six dosages, then every three months; (ii) every three weeks; (iii) 3 mg/kg body weight once followed by 1 mg/kg body weight every three weeks. [00227] Alternatively a mammalian polypeptide of interest can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the administered substance in the patient. In general, human antibodies show the longest half life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime. [00228] Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present disclosure may be varied so as to obtain an amount of the active ingredient which is 63 WO 2013/102674 PCT/EP2013/050126 effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts. [00229] A "therapeutically effective dosage" of an immunoglobulin of the present disclosure preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. For example, for the treatment of tumors, a "therapeutically effective dosage" preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects. The ability of a compound to inhibit tumor growth can be evaluated in an animal model system predictive of efficacy in human tumors. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to inhibit, such inhibition in vitro by assays known to the skilled practitioner. A therapeutically effective amount of a therapeutic compound can decrease tumor size, or otherwise ameliorate symptoms in a subject. One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected. [00230] A composition of the present disclosure can be administered via one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Certain routes of administration for binding moieties of the invention include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase "parenteral administration" as used herein means modes of administration other than enteral and topical 64 WO 2013/102674 PCT/EP2013/050126 administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion. [00231] Alternatively, a mammalian polypeptide according to the present disclosure can be administered via a nonparenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically. [00232] The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. (see, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978). [00233] Therapeutic compositions can be administered with medical devices known in the art. For example, in a certain embodiment, a therapeutic composition of the invention can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Patent Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules useful in the present invention include: U.S. Patent No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Patent No. 4,486,194, which discloses a therapeutic device for administering medicants through the skin; U.S. Patent No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Patent No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Patent No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Patent No. 4,475,196, which discloses an osmotic drug delivery system. 65 WO 2013/102674 PCT/EP2013/050126 [00234] In certain embodiments, the use of mammalian polypeptides according to the present disclosure is for the treatment of any disease that may be treated with therapeutic antibodies. Filamentous Fungal Cells of the Invention [00235] The invention herein also relates to increasing the levels of production of heterologous polypeptides, such as mammalian polypeptides, in filamentous fungal cells by reducing or eliminating the activity of at least three proteases found in cells that express heterologous polypeptides, and that catalyze the degradation of the heterologous polypeptides. Reducing or eliminating the activity of proteases found in the filamentous fungal cells that express heterologous polypeptides increases the stability of the expressed recombinant polypeptides, which results in an increased level of production of the heterologous polypeptides. The activity of the proteases found in the filamentous fungal cells may be reduced, for example, by modifying the genes encoding the proteases. [00236] "Filamentous fungal cells" include cells from all filamentous forms of the subdivision Eumycota and Oomycota (as defined by Hawksworth et al., In, Ainsworth and Bisby's Dictionary of The Fungi, 8th edition, 1995, CAB International, University Press, Cambridge, UK). Filamentous fungal cells are generally characterized by a mycelial wall composed of chitin, cellulose, glucan, chitosan, mannan, and other complex polysaccharides. Vegetative growth is by hyphal elongation and carbon catabolism is obligately aerobic. In contrast, vegetative growth by yeasts such as Saccharomyces cerevisiae is by budding of a unicellular thallus and carbon catabolism may be fermentative. [00237] Any filamentous fungal cell may be used in the present disclosure so long as it remains viable after being transformed with a sequence of nucleic acids and/or being modified or mutated to decrease protease activity. Preferably, the filamentous fungal cell is not adversely affected by the transduction of the necessary nucleic acid sequences, the subsequent expression of the proteins (e.g., mammalian proteins), or the resulting intermediates. [00238] Examples of suitable filamentous fungal cells include, without limitation, cells from an Acremonium, Aspergillus, Fusarium, Humicola, Mucor, Myceliophthora, Neurospora, 66 WO 2013/102674 PCT/EP2013/050126 Penicillium, Scytalidium, Thielavia, Tolypocladium, or Trichoderma strain. In certain embodiments, the filamentous fungal cell is from a Trichoderma sp., Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, or Tolypocladium strain. [00239] Aspergillus fungal cells of the present disclosure may include, without limitation, Aspergillus aculeatus, Aspergillus awamori, Aspergillus clavatus, Aspergillusflavus, Aspergillus foetidus, Aspergillus fumigatus, Aspergillus japonicus, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, or Aspergillus terreus. [00240] Neurospora fungal cells of the present disclosure may include, without limitation, Neurospora crassa. [00241] In certain embodiments, the filamentous fungal cell is not an Aspergillus cell. [00242] In certain embodiments, the filamentous fungal cell is selected from the group consisting of Trichoderma (T. reesei), Neurospora (N. crassa), Penicillium (P. chrysogenum), Aspergillus (A. nidulans, A. niger and A. oryzae), Myceliophthora (M. thermophila) and Chrysosporium (C. lucknowense). [00243] In certain embodiments, the filamentous fungal cell is a Trichoderma fungal cell. Trichoderma fungal cells of the present disclosure may be derived from a wild-type Trichoderma strain or a mutant thereof. Examples of suitable Trichoderma fungal cells include, without limitation, Trichoderma harzianum, Trichoderma koningii, Trichoderma longibrachiatum, Trichoderma reesei, Trichoderma atroviride, Trichoderma virens, Trichoderma viride; and alternative sexual form thereof (i.e., Hypocrea). [00244] General methods to disrupt genes of and cultivate filamentous fungal cells are disclosed, for example, for Penicillium, in Kopke et al. (2010) Application of the Saccharomyces cerevisiae FLP/FRT recombination system in filamentous fungi for marker recycling and 67 WO 2013/102674 PCT/EP2013/050126 construction of knockout strains devoid of heterologous genes. Apple Environ Microbiol. 76(14):4664-74. doi: 10.1128/AEM.00670-10, for Aspergillus, in Maruyama and Kitamoto (2011), Targeted Gene Disruption in Koji Mold Aspergillus oryzae, in James A. Williams (ed.), Strain Engineering: Methods and Protocols, Methods in Molecular Biology, vol. 765, DOI 10.1007/978-1-61779-197-0_27; for Neurospora, in Collopy et al. (2010) High-throughput construction of gene deletion cassettes for generation of Neurospora crassa knockout strains. Methods Mol Biol. 2010;638:33-40. doi: 10.1007/978-1-60761-611-5_3; and for Myceliophthora or Chrysosporium PCT/NL2010/000045 and PCT/EP98/06496. Filamentous Fungal Cell Components [00245] Certain aspects of the present disclosure relate to filamentous fungal cells having reduced or no detectable activity of at least three proteases and having a recombinant polynucleotide encoding a heterologous polypeptide that is produced at increased levels, for example at least two-fold increased levels. Other aspects of the present disclosure relate to Trichoderma fungal cells that has reduced or no detectable protease activity of at least three proteases selected from pep], pep2, pep3, pep4, pep5, pep8, pep]], pep12, tspl, sip], sip2, sip7, gap], and gap2, where the cell further contains a recombinant polynucleotide encoding a mammalian polypeptide produced at a level of at least 2-fold higher than the production level of the polypeptide in a corresponding parental Trichoderma fungal cell. In certain embodiments, the filamentous fungal cells or Trichoderma fungal cells have reduced or no activity of at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, at least twelve, or more proteases. Reduced expression of proteases [00246] The reduced activity of the at least three proteases in filamentous fungal cells or Trichoderma fungal cells of the present disclosure can be the result of reduced or eliminated expression of the proteases. In some embodiments, the reduced or eliminated expression of the at least three proteases is the result of a modification to the catalytic domain, the coding region, or a control sequence required for expression of the coding region of the genes encoding each of the 68 WO 2013/102674 PCT/EP2013/050126 proteases. In other embodiments, the reduced or eliminated expression of the proteases is the result of introducing, substituting, and/or removing one or more nucleotides in the genes, or a control sequence thereof required for the transcription or translation of the genes encoding each of the proteases. [00247] In further embodiments, the reduced or eliminated expression of the proteases is the result of inserting into the genes encoding each of the proteases disruptive nucleic acid constructs each containing a nucleic acid fragment homologous to each of the genes that will create a duplication of the region of homology and incorporate construct DNA between the duplicated regions. In other embodiments, the reduced or eliminated expression of the proteases is the result of gene conversion of the genes encoding each of the proteases. In still other embodiments, the reduced or eliminated expression of the proteases is the result of by anti-sense polynucleotides or RNAi constructs that are specific for the each of the genes encoding each of the proteases. In one embodiment, an RNAi construct is specific for a gene encoding an aspartic protease such as a pep-type protease, a trypsin-like serine proteases such as a tsp1, a glutamic protease such as a gap-type protease, a subtilisin protease such as a slp-type protease, or a sedolisin protease such as a tpp1 or a sip7 protease. In one embodiment, an RNAi construct is specific for the gene encoding a slp-type protease. In one embodiment, an RNAi construct is specific for the gene encoding sip2, sip3, sip5 or sip6. In one embodiment, an RNAi construct is specific for two or more proteases. In one embodiment, two or more proteases are any one of the pep-type proteases, any one of the trypsin-like serine proteasess, any one of the slp-type proteases, any one of the gap-type proteases and/or any one of the sedolisin proteases. In one embodiment, two or more proteases are sip2, sip3, sip5 and/or sip6. In one embodiment, RNAi construct comprises any one of nucleic acid sequences of Table 22.2. [00248] In some embodiments, the genes encoding the proteases each contain a mutation that reduces or eliminates the corresponding protease activity. In other embodiments, the mutation reduces or eliminates the expression of each of the proteases. In further embodiments, the mutation is a knock-out mutation, a truncation mutation, a point mutation, a missense mutation, a substitution mutation, a frameshift mutation, an insertion mutation, a duplication mutation, an 69 WO 2013/102674 PCT/EP2013/050126 amplification mutation, a translocation mutation, an inversion mutation that reduces or eliminates the corresponding protease activity. [00249] In some embodiments, the mutation is a deletion of the protease encoding gene. In other embodiments, the mutation is a deletion of the portion of the protease encoding gene encoding the catalytic domain of the protease. In still other embodiments, the mutation is point mutation in the portion of the protease encoding gene encoding the catalytic domain of the protease. Combinations ofprotease genes [00250] The filamentous fungal cells or Trichoderma fungal cells of the present disclosure may contain at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more aspartic proteases, trypsin-like serine proteases, subtilisin proteases, and/or glutamic proteases. In certain embodiments, the proteases are encoded by pep type protease genes, gap-type protease genes, or slp-type proteases genes. In some embodiments, the pep-type protease genes are selected from pep], pep2, pep3, pep4, pep5, pep8, pep]], and pep12. In other embodiments, the gap-type protease genes are selected from gap], and gap2. In further embodiments, the slp-type proteases genes are selected from sip], sip2, sip3, and sip7; or are selected from sip], sip2, sip3, sip5, sip6, sip7, and sip8. In certain preferred embodiments, the slp-type proteases gene is sip]. [00251] In other embodiments, the proteases are encoded by genes selected from pep], pep2, pep3, pep4, pep5, pep7, pep8, pep]], pep12, tspl, sip], sip2, sip3, sip5, sip6, sip7, sip8, gap], gap2, and tpp]. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of at least three or at least four protease encoding genes selected from pep], pep2, pep3, pep4, pep5, pep8, pep]], pep12, tspl, sip], sip2, sip3, sip7, gap], and gap2. In certain embodiments, the filamentous fungal cell, for example a Trichoderma cell, has reduced or no expression levels of at least three protease encoding genes selected from pep], tsp], and sip]. In other embodiments, the filamentous fungal cell, or Trichoderma cell, has reduced or no expression levels of at least three protease encoding genes selected from gap], sip] 70 WO 2013/102674 PCT/EP2013/050126 and pep]. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep],and gap]. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep], gap], and pep4. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep], gap], pep4, and sip]. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep], gap], pep4, sip], and sip3. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep], gap], pep4, sip], sip3, and pep3. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep], gap], pep4, sip], sip3, pep3, and pep2. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep], gap], pep4, sip], sip3, pep3, pep2, and pep5. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep1,gap1, pep4, sip], sip3, pep3, pep2, pep5, and tsp]. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep],gap], pep4, sip], sip3, pep3, pep2, pep5, tspl, and sip7. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep],gap], pep4, sip], sip3, pep3, pep2, pep5, tspl, sip7, and sip8. In some embodiments, the filamentous fungal cell, for example, a Trichoderma cell has reduced or no expression levels of protease encoding genes sip2, pep1,gap1, pep4, sip], sip3, pep3, pep2, pep5, tspl, sip7, sip8, and gap2. [00252] In certain embodiments, the filamentous fungal cell has at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more proteases with reduced protease activity, wherein the corresponding proteases with wild type activity each have an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the 71 WO 2013/102674 PCT/EP2013/050126 amino acid sequences of SEQ ID NOs: 1-16; 17-36; 37-57; 58-65; 66-81; 82-97; 98-117; 118 128; 129-144; 166-181; 182-185; or SEQ ID NOs:491-588. In embodiments where the filamentous fungal cell is a Trichoderma fungal cell with reduced protease activity in one or more proteases,wherein the corresponding proteases with wild type activity each have an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequences of SEQ ID NOs: 1, 17, 37, 58, 66, 82, 98, 118, 129, 166, or 182; or SEQ ID NO:507, SEQ ID NO:522, or SEQ ID NO:530. Heterologous polypeptides [00253] The filamentous fungal cells or Trichoderma fungal cells of the present disclosure contain a recombinant polynucleotide encoding a heterologous polypeptide. In certain embodiments, the heterologous polypeptide is a mammalian polypeptide. In other embodiments, heterologous polypeptide is a non-mammalian polypeptide. [00254] In embodiments where the filamentous fungal cell contains a recombinant polynucleotide encoding a mammalian polypeptide, the mammalian polypeptide can be a non glycosylated mammalian polypeptide, a glycosylated mammalian polypeptide, or combinations thereof, including, without limitation, an immunoglobulin, an antibody, a growth factor, and an interferon. In some embodiments, the mammalian polypeptide is an immunoglobulin or antibody. In embodiments where the filamentous fungal cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody, the filamentous fungal cell, for example, a Trichoderma fungal cell may have reduced or no expression of at least three or at least four protease encoding genes selected from pep], pep3, pep4, pep8, pep]], pep12, tspl, sip], sip2, sip7, gap], and gap2. In certain preferred embodiments, the cell, for example a Trichoderma fungal cell, contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced or no expression of the protease encoding genes sip], sip2, sip3, tsp], pep], gap], pep4, pep3, pep2, pep5, and gap2. In certain preferred embodiments, the cell, for example a Trichoderma fungal cell, contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced or no expression of the protease encoding genes 72 WO 2013/102674 PCT/EP2013/050126 pep], tsp], sip1, and gap]. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes pep], tsp], sip], gap], and pep4. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes sip], sip2, and sip3. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes sip], sip2, sip3, and tsp]. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes sip], sip2, sip3, tsp], and pep]. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes sip], sip2, sip3, tsp], pep], and gap]. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes sip], sip2, sip3, tsp], pep], gap], and pep4. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes sip], sip2, sip3, tspl, pep], gap], pep4, and pep3. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes sip], sip2, sip3, tsp], pep], gap], pep4, pep3, and pep2. In other embodiments, the cell contains a recombinant polynucleotide encoding an immunoglobulin or antibody and has reduced expression of the protease encoding genes sip], sip2, sip3, tspl, pep], gap], pep4, pep3, pep2, and pep5. [00255] In other embodiments, the filamentous fungal cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, or interleukin. In embodiments where the filamentous fungal cell, for example a Trichoderma fungal cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin, the filamentous fungal cell may have reduced or no expression of at least three or at least four protease encoding genes selected from pep], pep2, pep3, pep4, pep5, pep8, gap], gap2, sip], sip2, sip7, and tsp]. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or 73 WO 2013/102674 PCT/EP2013/050126 interleukin and has reduced expression of the protease encoding genes pep], tsp1, sip], gap], and gap2. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes sip], sip2, pep], gap], pep4, sip7, pep2, pep3, pep5, tspl, and gap2. In other embodiments, the cell, for example a Trichoderma fungal cell, contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], tsp], sip], gap], gap2, and pep4. In a further embodiment, the cell contains a recombinant polynucleotide encoding a growth factor, and has reduced expression of a pep-type protease genes are selected from pep], pep2, pep3, pep4, and pep5. In certain preferred embodiments, the growth factor is IGF-1 or the interferon is interferon-a 2b. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], gap], and pep4. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], gap], pep4, and sip7. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], gap], pep4, sip7, and sip2. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], gap], pep4, sip7, sip2, and pep2. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], gap], pep4, sip7, sip2, pep2, and pep3. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], gap], pep4, sip 7, sip2, pep2, pep3, and pep5. In certain embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], gap], pep4, sip7, sip2, pep2, pep3, pep5, and sip]. In certain 74 WO 2013/102674 PCT/EP2013/050126 embodiments, the cell contains a recombinant polynucleotide encoding a growth factor, interferon, cytokine, human serum albumin, or interleukin and has reduced expression of the protease encoding genes pep], gap], pep4, sip7, sip2, pep2, pep3, pep5, sip], and tspl. [00256] In certain embodiments, the mammalian polypeptide is produced at a level that is at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9 fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 30-fold, at least 40 fold, at least 50-fold, at least 60-fold, at least 70-fold, at least 75-fold, at least 80-fold, at least 90 fold, at least 100-fold, or a greater fold higher than the production level of the polypeptide in a corresponding parental filamentous fungal cell without the reduced protease activity. In other embodiments, the mammalian polypeptide is produced in a full length version at a level higher than the production level of the full-length version of the polypeptide in a corresponding parental filamentous fungal cell. [00257] In embodiments where the filamentous fungal cell contains a recombinant polynucleotide encoding a non-mammalian polypeptide, the non-mammalian polypeptide may be an aminopeptidase, amylase, carbohydrase, carboxypeptidase, catalase, cellulase, chitinase, cutinase, deoxyribonuclease, esterase, alpha-galactosidase, beta-galactosidase, glucoamylase, alpha-glucosidase, beta-glucosidase, invertase, laccase, lipase, mutanase, oxidase, pectinolytic enzyme, peroxidase, phospholipase, phytase, polyphenoloxidase, proteolytic enzyme, ribonuclease, transglutaminase or xylanase. In embodiments where the filamentous fungal cell contains a recombinant polynucleotide encoding a non-mammalian polypeptide, the filamentous fungal cell may have reduced or no detectable expression of at least three, at least four, at least five, or at least six protease encoding genes selected from pep], pep2, pep3, pep4, pep5, pep8, pep]1, pep12, tspl, sip], sip2, sip3, gap], and gap2. In certain embodiments, the non mammalian polypeptide is produced at a level that is at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15-fold, at least 20-fold, at least 25-fold, at least 30-fold, at least 40-fold, at least 50-fold, at least 60-fold, at least 70-fold, at least 75-fold, at least 80-fold, at least 90-fold, at least 100-fold, or a greater fold higher than the production level of the polypeptide in a corresponding parental filamentous fungal cell. In other embodiments, the non-mammalian polypeptide is produced in a full length 75 WO 2013/102674 PCT/EP2013/050126 version at a level higher than the production level of the full-length version of the polypeptide in a corresponding parental filamentous fungal cell. Reduced activity of additional proteases [00258] In some embodiments, the filamentous fungal cells or Trichoderma fungal cells of the present disclosure also have reduced activity of one or more additional proteases. In certain embodiments, the expression level of the one or more additional proteases is reduced. In certain preferred embodiments, genes encoding the one or more additional proteases each comprise a mutation that reduces the corresponding protease activity. The one or more additional protease encoding genes may be pep7, tppl, gap2, sip3, sip5, sip6, sip7, or sip8. [00259] In certain embodiments, when the filamentous fungal cells is an Aspergillus cell, the total protease activity is reduced to 50% or less of the total protease activity in the corresponding parental Aspergillus cell in which the proteases do not have reduced activity. [00260] In certain embodiments, total protease activity is reduced in the cell of the present disclosure, for example a Trichoderma cell, to 49% or less, 31% or less, 13% or less, 10% or less, 6.3% or less, or 5.5% or less, of the total protease activity in the corresponding parental filamentous fungal cell in which the proteases do not have reduced activity. Additional recombinant modifications [00261] In certain embodiments, the filamentous fungal cells or Trichoderma fungal cells of the present disclosure also have reduced activity of a dolichyl-P-Man:Man(5)GlcNAc(2)-PP dolichyl mannosyltransferase. Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase (EC 2.4.1.130) transfers an alpha-D-mannosyl residue from dolichyl phosphate D-mannose into a membrane lipid-linked oligosaccharide. Typically, the dolichyl-P Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase enzyme is encoded by an alg3 gene. Thus, in certain embodiments, the filamentous fungal cell has reduced activity of ALG3, which is the activity encoded by the alg3 gene. In some embodiments, the alg3 gene contains a mutation 76 WO 2013/102674 PCT/EP2013/050126 that reduces the corresponding ALG3 activity. In certain embodiments, the alg3 gene is deleted from the filamentous fungal cell. [00262] In other embodiments, the filamentous fungal cells or Trichoderma fungal cells of the present disclosure further contain a polynucleotide encoding an a-1,2-mannosidase. The polynucleotide encoding the a-1,2-mannosidase may be endogenous in the host cell, or it may be heterologous to the host cell. These polynucleotides are especially useful for a filamentous fungal cell expressing high-mannose glycans transferred from the Golgi to the ER without effective exo-a-2-mannosidase cleavage. The a-1,2-mannosidase may be a mannosidase I type enzyme belonging to the glycoside hydrolase family 47 (cazy.org/GH47_all.html). In certain embodiments the a-1,2-mannosidase is an enzyme listed at cazy.org/GH47_characterized.html. In particular, the a-1,2-mannosidase may be an ER-type enzyme that cleaves glycoproteins such as enzymes in the subfamily of ER a-mannosidase I EC 3.2.1.113 enzymes. Examples of such enzymes include human a-2-mannosidase lB (AAC26169), a combination of mammalian ER mannosidases, or a filamentous fungal enzyme such as a-1,2-mannosidase (MDS1) (T. reesei AAF34579; Maras M et al J Biotech. 77, 2000, 255). For ER/Golgi expression the catalytic domain of the mannosidase is typically fused with a targeting peptide, such as HDEL, KDEL, or part of an ER or early Golgi protein, or expressed with an endogenous ER targeting structures of an animal or plant mannosidase I enzyme, see, for example, Callewaert et al. 2001 Use of HDEL tagged Trichoderma reesei mannosyl oligosaccharide 1,2-a-D-mannosidase for N-glycan engineering in Pichia pastoris. FEBS Lett 503: 173-178. [00263] In further embodiments, the filamentous fungal cells or Trichoderma fungal cells of the present disclosure also contain an N-acetylglucosaminyltransferase I catalytic domain and an N-acetylglucosaminyltransferase II catalytic domain. Such catalytic domains are useful for expressing complex N-glycans in non-mammalian cells. N-acetylglucosaminyltransferase I (GlcNAc-TI; GnTI; EC 2.4.1.101) catalyzes the reaction UDP-N-acetyl-D-glucosamine + 3 (alpha-D-mannosyl)-beta-D-mannosyl-R <=> UDP + 3-(2-(N-acetyl-beta-D-glucosaminyl) alpha-D-mannosyl)-beta-D-mannosyl-R, where R represents the remainder of the N-linked oligosaccharide in the glycan acceptor. An N-acetylglucosaminyltransferase I catalytic domain is any portion of an N-acetylglucosaminyltransferase I enzyme that is capable of catalyzing this 77 WO 2013/102674 PCT/EP2013/050126 reaction. N-acetylglucosaminyltransferase II (GlcNAc-TII; GnTII; EC 2.4.1.143) catalyzes the reaction UDP-N-acetyl-D-glucosamine + 6-(alpha-D-mannosyl)-beta-D-mannosyl-R <=> UDP + 6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R, where R represents the remainder of the N-linked oligosaccharide in the glycan acceptor. An N acetylglucosaminyltransferase II catalytic domain is any portion of an N acetylglucosaminyltransferase II enzyme that is capable of catalyzing this reaction. Examples of suitable N-acetylglucosaminyltransferase I catalytic domains and an N acetylglucosaminyltransferase II catalytic domains can be found in International Patent Application No. PCT/EP2011/070956. The N-acetylglucosaminyltransferase I catalytic domain and N-acetylglucosaminyltransferase II catalytic domain can be encoded by a single polynucleotide. In certain embodiments, the single polynucleotide encodes a fusion protein containing the N-acetylglucosaminyltransferase I catalytic domain and the N acetylglucosaminyltransferase II catalytic domain. Alternatively, the N acetylglucosaminyltransferase I catalytic domain can be encoded by a first polynucleotide and the N-acetylglucosaminyltransferase II catalytic domain can be encoded by a second polynucleotide. [00264] In embodiments where, the filamentous fungal cell or Trichoderma fungal cell contains an N-acetylglucosaminyltransferase I catalytic domain and an N acetylglucosaminyltransferase II catalytic domain, the cell can also contain a polynucleotide encoding a mannosidase II. Mannosidase II enzymes are capable of cleaving Man5 structures of GlcNAcMan5 to generate GlcNAcMan3, and if combined with action of a catalytic domain of GnTII, to generate GO; and further, with action of a catalytic domain of a galactosyltransferase, to generate GI and G2. In certain embodiments mannosidase II-type enzymes belong to glycoside hydrolase family 38 (cazy.org/GH38_all.html). Examples of such enzymes include human enzyme AAC50302, D. melanogaster enzyme (Van den Elsen J.M. et al (2001) EMBO J. 20: 3008-3017), those with the 3D structure according to PDB-reference 1HTY, and others referenced with the catalytic domain in PDB. For ER/Golgi expression, the catalytic domain of the mannosidase is typically fused with an N-terminal targeting peptide, for example using targeting peptides listed in the International Patent Application No. PCT/EP2011/070956 or of 78 WO 2013/102674 PCT/EP2013/050126 SEQ ID NOs 589-594. After transformation with the catalytic domain of a mannosidase II-type mannosidase, a strain effectively producing GlcNAc2Man3, GlcNAc1Man3 or GO is selected. [00265] In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a polynucleotide encoding a UDP-GlcNAc transporter. [00266] In certain embodiments that may be combined with the preceding embodiments, the filamentous fungal cell further contains a polynucleotide encoding a p-1,4-galactosyltransferase. Generally, P-1,4-galactosyltransferases belong to the CAZy glycosyltransferase family 7 (cazy.org/GT7_all.html). Examples of useful I4GalT enzymes include I4GalT1, e.g. bovine Bos taurus enzyme AAA30534.1 (Shaper N.L. et al Proc. Natl. Acad. Sci. U.S.A. 83 (6), 1573-1577 (1986)), human enzyme (Guo S. et al. Glycobiology 2001, 11:813-20), and Mus musculus enzyme AAA37297 (Shaper, N.L. et al. 1998 J. Biol. Chem. 263 (21), 10420-10428). In certain embodiments of the invention where the filamentous fungal cell contains a polynucleotide encoding a galactosyltransferase, the filamentous fungal cell also contains a polynucleotide encoding a UDP-Gal 4 epimerase and/or UDP-Gal transporter. In certain embodiments of the invention where the filamentous fungal cell contains a polynucleotide encoding a galactosyltransferase, lactose may be used as the carbon source instead of glucose when culturing the host cell. The culture medium may be between pH 4.5 and 7.0 or between 5.0 and 6.5. In certain embodiments of the invention where the filamentous fungal cell contains a polynucleotide encoding a galactosyltransferase and, optionally, a polynucleotide encoding a UDP-Gal 4 epimerase and/or UDP-Gal transporter, a divalent cation such as Mn2+, Ca2+ or Mg2+ may be added to the cell culture medium. [00267] In certain embodiments that may be combined with the preceding embodiments, the level of activity of alpha- 1,6-mannosyltransferase in the host cell is reduced compared to the level of activity in a wild-type host cell. In certain embodiments, the filamentous fungal has a reduced level of expression of an ochl gene compared to the level of expression in a wild-type filamentous fungal cell. 79 WO 2013/102674 PCT/EP2013/050126 [00268] Another aspect includes methods of producing a Man3GlcNAc2 N-glycan [i.e. Mana3(Mana6)Man 4GcNAc 4GlcNAc] in a filamentous fungal cell including the steps of providing a filamentous fungal cell with a recombinant polynucleotide encoding a heterologous polypeptide and a reduced level of activity of an alg3 mannosyltransferase compared to the level of activity in a wild-type filamentous fungal cell and culturing the filamentous fungal cell to produce a Man3GlcNAc2 glycan, where the Man3GlcNAc2 glycan constitute at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the neutral N-glycans secreted by the filamentous fungal cell. In certain embodiment, Man3GlcNAc2 N-glycan represents at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the total N-glycans of the heterologous polypeptide. [00269] Another aspect includes methods of producing a complex N-glycan (i.e an N-glycan comprising a terminal GlcNAc2Man3 structure), for example GlcNAc2Man3GlcNAc2 {i.e. GO, i.e. GlcNAcp2Mana3(GlcNAc 2Mana6)Man 4GlcNAc 4GlcNAc} glycan in a filamentous fungal cell including the steps of providing a filamentous fungal cell with a recombinant polynucleotide encoding a heterologous polypeptide, a reduced level of activity of an alg3 mannosyltransferase compared to the level of activity in a wild-type filamentous fungal cell and comprising further a polynucleotide encoding an N-acetylglucosaminyltransferase I catalytic domain and a polynucleotide encoding an N-acetylglucosaminyltransferase II catalytic domain and culturing the filamentous fungal cell to produce the complex N-glycan, for example GlcNAc2Man3GlcNAc2 glycan, where the GlcNAc2Man3GlcNAc2 glycan constitutes at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the neutral N-glycans secreted by the filamentous fungal cell. In certain embodiments, the complex N-glycan, for example GlcNAc2Man3GlcNAc2 glycan, represents at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %)of the total N-glycans of the polypeptide. In certain embodiments, said complex N glycans are GlcNAcMan3 and/or GlcNAc2Man3. 80 WO 2013/102674 PCT/EP2013/050126 [00270] Another aspect includes methods of producing a GI or G2 N-glycan or mixture thereof, for example GalGlcNAc2Man3GlcNAc2 {i.e. GI, i.e. Galp4GlcNAcp2Mana3(GlcNAcp2Mana6)Man 4GlcNAcp4GlcNAc} or GlcNAc p2Mana3(Gal p4GlcNAc p2Mana6)Man4GlcNAc p4GlcNAc } and/or Gal2GlcNAc2Man3GlcNAc2 {i.e. G2, i.e. Gal p4GlcNAcp2Mana3(Galp 4 GlcNAcp2Mana6)Manp4GlcNAc p4GlcNAcI glycan in a filamentous fungal cell including the steps of providing a filamentous fungal cell with a recombinant polynucleotide encoding a heterologous polypeptide and a reduced level of activity of an alg3 mannosyltransferase compared to the level of activity in a wild-type filamentous fungal cell and comprising further a polynucleotide encoding an N-acetylglucosaminyltransferase I catalytic domain, a polynucleotide encoding an N-acetylglucosaminyltransferase II catalytic domain, and a polynucleotide encoding a GalT catalytic domain and culturing the filamentous fungal cell to produce the GI or G2 N glycan or mixture thereof, where GI glycan constitutes at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the neutral N-glycans secreted by the filamentous fungal cell, or where the G2 glycan constitutes at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the neutral N-glycans secreted by the filamentous fungal cell. In certain embodiment, GI glycan constitutes at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the total N-glycans of the polypeptide. In certain embodiment, G2 glycan constitutes at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the total N glycans of the polypeptide. [00271] In certain embodiments, the method of producing a complex N-glycan will generate a mixture of different glycans. The complex N-glycan or Man3GlcNAc2 may constitute at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%), or at least 90% or more of such a glycan mixture. In certain embodiments, at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%), or at least 90% or more of the N-glycans of the polypeptide consists of such a 81 WO 2013/102674 PCT/EP2013/050126 glycan mixture. In certain embodiments, the method of producing a complex and GI and/or G2 N-glycan will generate a mixture of different glycans. The complex N-glycan, Man3GlcNAc2, GI and/or G2 may constitute at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%), or at least 90% or more of such a glycan mixture. In certain embodiments, at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%), or at least 90% or more of of the N glycans of the polypeptide consists of such a glycan mixture. [00272] In certain embodiments, methods of producing a hybrid N-glycan are desirable. As used herein, the term "hybrid" means a glycan containing both unsubstituted terminal mannose residues (as are present in high-mannose glycans) and substituted mannose residues with an N acetylglucosamine linkage, for example GlcNAc p2Mana3 [Mana3(Mana6)Manac6]Man 34GlcNAc p4GlcNAc. In such embodiments, a Man5 {i.e Mana3[Mana3(Mana6) Mana6]Man4GlcNAcp4GlcNAc} expressing filamentous fungal cell such as T. reesei strain is transformed with a recombinant polynucleotide encoding a heterologous polypeptide and a polynucleotide encoding an N-acetylglucosaminyltransferase I catalytic domain and the filamentous fungal cell is cultured to produce the hybrid N-glycan where the hybrid N-glycan constitutes at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the neutral N-glycans secreted by the filamentous fungal cell. In certain embodiment, at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% (mol %) of the N-glycans of the polypeptide consists of a hybrid N glycan. [00273] The Man3GlcNAc2, complex, hybrid, GI, and G2 N-glycan may be attached to a molecule selected from an amino acid, a peptide, and a polypeptide. In certain embodiments, the Man3GlcNAc2, complex, hybrid, GI, and G2 N-glycan is attached to a heterologous polypeptide. In certain embodiments, the heterologous polypeptide is a glycosylated protein. In certain embodiment, the glycosylated polypeptide is a mammalian polypeptide. In certain embodiments, mammalian polypeptide is an antibody or its antigen-binding fragment. 82 WO 2013/102674 PCT/EP2013/050126 [00274] In certain embodiments, glycosyltransferases, or example, GnTI, GnTII, or GaiT or glycosylhydrolases, for example, a-1,2-mannosidase or mannosidase II, include a targeting peptide linked to the catalytic domains. The term "linked" as used herein means that two polymers of amino acid residues in the case of a polypeptide or two polymers of nucleotides in the case of a polynucleotide are either coupled directly adjacent to each other or are within the same polypeptide or polynucleotide but are separated by intervening amino acid residues or nucleotides. A "targeting peptide", as used herein, refers to any number of consecutive amino acid residues of the recombinant protein that are capable of localizing the recombinant protein to the endoplasmic reticulum (ER) or Golgi apparatus (Golgi) within the filamentous fungal cell. The targeting peptide may be N-terminal or C-terminal to the catalytic domains. In certain embodiments, the targeting peptide is N-terminal to the catalytic domains. In certain embodiments, the targeting peptide provides direct binding to the ER or Golgi membrane. Components of the targeting peptide may come from any enzyme that normally resides in the ER or Golgi apparatus. Such enzymes include mannosidases, mannosyltransferases, glycosyltransferases, Type 2 Golgi proteins, and MNN2, MNN4, MNN6, MNN9, MNN1O, MNS1, KRE2, VANI, and OCHI enzymes. Suitable targeting peptides are described in the International Patent Application No. PCT/EP2011/070956. In one embodiment, the targeting peptide of GnTI or GnTII is human GnTII enzyme. In other embodiments, targeting peptide is derived from Trichoderma Kre2, Kre2-like, Och1, Anp1, and Van]. In one embodiment, the targeting peptide is selected from the group of SEQ ID NOs: 589-594. Uses of the Filamentous Fungal Cells of the Invention [00275] The invention herein further relates to methods of using any of the filamentous fungal cells of the present disclosure, such as Trichoderma fungal cells, that have reduced or no protease activity of at least three proteases and that contain a recombinant polynucleotide encoding a heterologous polypeptide, such as a mammalian polypeptide, that is produced at increased levels, for improving heterologous polypeptide stability and for making a heterologous polypeptide. Methods of measuring protein stability and for making a heterologous polypeptide are well known, and include, without limitation, all the methods and techniques described in the present disclosure. 83 WO 2013/102674 PCT/EP2013/050126 [00276] Accordingly, certain embodiments of the present disclosure relate to methods of improving heterologous polypeptide stability, by: a) providing a filamentous fungal cell of the present disclosure having reduced or no activity of at least three proteases, where the cell further contains a recombinant polynucleotide encoding a heterologous polypeptide; and b) culturing the cell such that the heterologous polypeptide is expressed, where the heterologous polypeptide has increased stability compared to a host cell not containing the mutations of the genes encoding the proteases. Other embodiments of the present disclosure relate to methods of improving mammalian polypeptide stability, by: a) providing a Trichoderma fungal cell of the present disclosure having reduced or no activity of at least three proteases, where the cell further contains a recombinant polynucleotide encoding a mammalian polypeptide; and b) culturing the cell such that the mammalian polypeptide is expressed, where the mammalian polypeptide has increased stability compared to a host cell not containing the mutations of the genes encoding the proteases. The filamentous fungal cell or Trichoderma fungal cell may be any cell described in the section entitled "Filamentous Fungal Cells of the Invention". Methods of measuring polypeptide stability and for culturing filamentous fungal and Trichoderma fungal cells are well known in the art, and include, without limitation, all the methods and techniques described in the present disclosure. [00277] In certain embodiments, the stability of the heterologous polypeptide or mammalian polypeptide is increased by at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6 fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15-fold, at least 20 fold, at least 25-fold, at least 30-fold, at least 40-fold, at least 50-fold, at least 60-fold, at least 70 fold, at least 75-fold, at least 80-fold, at least 90-fold, at least 100-fold, or a greater fold higher compared to a heterologous polypeptide or mammalian polypeptide expressed in a corresponding parental filamentous fungal or Trichoderma fungal cell. [00278] Other embodiments of the present disclosure relate to methods of making a heterologous polypeptide, by: a) providing a filamentous fungal cell of the present disclosure having reduced or no activity of at least three proteases, where the cell further contains a recombinant polynucleotide encoding a heterologous polypeptide; b) culturing the host cell such that the heterologous polypeptide is expressed; and c) purifying the heterologous polypeptide. 84 WO 2013/102674 PCT/EP2013/050126 Further embodiments of the present disclosure relate to methods of making a mammalian polypeptide, by: a) providing a Trichoderma fungal cell of the present disclosure having reduced or no activity of at least three protease, where the cell further contains a recombinant polynucleotide encoding a mammalian polypeptide; b) culturing the host cell such that the mammalian polypeptide is expressed; and c) purifying the mammalian polypeptide. The filamentous fungal cell or Trichoderma fungal cell may be any cell described in the section entitled "Filamentous Fungal Cells of the Invention". Methods of culturing filamentous fungal and Trichoderma fungal cells and purifying polypeptides are well known in the art, and include, without limitation, all the methods and techniques described in the present disclosure. [00279] In certain embodiments, the filamentous fungal cell or Trichoderma fungal cell is cultured at a pH range selected from pH 3.5 to 7; pH 3.5 to 6.5; pH 4 to 6; pH 4.3 to 5.7; pH 4.4 to 5.6; and pH 4.5 to 5.5. In certain embodiments, to produce an antibody the filamentous fungal cell or Trichoderma fungal cell is cultured at a pH range selected from 4.7 to 6.5; pH 4.8 to 6.0; pH 4.9 to 5.9; and pH 5.0 to 5.8. [00280] In some embodiments, the heterologous polypeptide is a mammalian polypeptide. In other embodiments, the heterologous polypeptide is a non-mammalian polypeptide. [00281] In certain embodiments, the mammalian polypeptide is selected from an immunoglobulin, immunoglobulin heavy chain, an immunoglobulin light chain, a monoclonal antibody, a hybrid antibody, an F(ab')2 antibody fragment, an F(ab) antibody fragment, an Fv molecule, a single-chain Fv antibody, a dimeric antibody fragment, a trimeric antibody fragment, a functional antibody fragment, a single domain antibody, multimeric single domain antibodies, an immunoadhesin, insulin-like growth factor 1, a growth hormone, insulin, and erythropoietin. In other embodiments, the mammalian protein is an immunoglobulin or insulin-like growth factor 1. In yet other embodiments, the mammalian protein is an antibody. In further embodiments, the yield of the mammalian polypeptide is at least 0.5, at least 1, at least 2, at least 3, at least 4, or at least 5 grams per liter. In certain embodiments, the mammalian polypeptide is an antibody, optionally, IgGI, IgG2, IgG3, or IgG4. In further embodiments, the yield of the antibody is at least 0.5, at least 1, at least 2, at least 3, at least 4, or at least 5 grams per liter. In still other 85 WO 2013/102674 PCT/EP2013/050126 embodiments, the mammalian polypeptide is a growth factor or a cytokine. In further embodiments, the yield of the growth factor or cytokine is at least 0.1, at least 0.2, at least 0.3, at least 0.4, at least 0.5, at least 1, at least 1.5, at least 2, at least 3, at least 4, or at least 5 grams per liter. In further embodiments, the mammalian polypeptide is an antibody, and the antibody contains at least 70 %, at least 80 %, at least 90 %, at least 95 %, or at least 98 % of a natural antibody C-terminus and N-terminus without additional amino acid residues. In other embodiments, the mammalian polypeptide is an antibody, and the antibody contains at least 70 %, at least 80 %, at least 90 %, at least 95 %, or at least 98 % of a natural antibody C-terminus and N-terminus that do not lack any C-terminal or N-terminal amino acid residues [00282] In certain embodiments where the mammalian polypeptide is purified from cell culture, the culture containing the mammalian polypeptide contains polypeptide fragments that make up a mass percentage that is less than 50%, less than 40%, less than 30%, less than 20%, or less than 10% of the mass of the produced polypeptides. In certain preferred embodiments, the mammalian polypeptide is an antibody, and the polypeptide fragments are heavy chain fragments and/or light chain fragments. In other embodiments, where the mammalian polypeptide is an antibody and the antibody purified from cell culture, the culture containing the antibody contains free heavy chains and/or free light chains that make up a mass percentage that is less than 50%, less than 40%, less than 30%, less than 20%, or less than 10% of the mass of the produced antibody. Methods of determining the mass percentage of polypeptide fragments are well known in the art and include, measuring signal intensity from an SDS-gel. [00283] In further embodiments, the non-mammalian polypeptide is selected from an aminopeptidase, amylase, carbohydrase, carboxypeptidase, catalase, cellulase. chitinase, cutinase, deoxyribonuclease, esterase, alpha-galactosidase, beta-galactosidase, glucoamylase, alpha glucosidase, beta-glucosidase, invertase, laccase, lipase, mutanase, oxidase, pectinolytic enzyme, peroxidase, phospholipase, phytase, polyphenoloxidase, proteolytic enzyme, ribonuclease, transglutaminase, and xylanase. [00284] In certain embodiments of any of the disclosed methods, the method includes the further step of providing one or more, two or more, three or more, four or more, or five or more 86 WO 2013/102674 PCT/EP2013/050126 protease inhibitors. In certain embodiments, the protease inhibitors are peptides that are co expressed with the mammalian polypeptide. In other embodiments, the inhibitors inhibit at least two, at least three, or at least four proteases from a protease family selected from aspartic proteases, trypsin-like serine proteases, subtilisin proteases, and glutamic proteases. [00285] In certain embodiments of any of the disclosed methods, the filamentous fungal cell or Trichoderma fungal cell also contains a carrier protein. As used herein, a "carrier protein" is portion of a protein that is endogenous to and highly secreted by a filamentous fungal cell or Trichoderma fungal cell. Suitable carrier proteins include, without limitation, those of T. reesei mannanase I (Man5A, or MANI), T. reesei cellobiohydrolase II (Cel6A, or CBHII) (see, e.g., Paloheimo et al Appl. Environ. Microbiol. 2003 December; 69(12): 7073-7082) or T. reesei cellobiohydrolase I (CBHI). In some embodiments, the carrier protein is CBH1. In other embodiments, the carrier protein is a truncated T. reesei CBH1 protein that includes the CBH1 core region and part of the CBH1 linker region. In some embodiments, a carrier such as a cellobiohydrolase or its fragment is fused to an antibody light chain and/or an antibody heavy chain. In some embodiments, a carrier such as a cellobiohydrolase or its fragment is fused to insulin-like growth factor 1, growth hormone, insulin, interferon alpha 2b, fibroblast growth factor 21, or human serum albumin. In some embodiments, a carrier-antibody fusion polypeptide comprises a Kex2 cleavage site. In certain embodiments, Kex2, or other carrier cleaving enzyme, is endogenous to a filamentous fungal cell. In certain embodiments, carrier cleaving protease is heterologous to the filamentous fungal cell, for example, another Kex2 protein derived from yeast or a TEV protease. In certain embodiments, carrier cleaving enzyme is overexpressed. [00286] It is to be understood that, while the invention has been described in conjunction with the certain specific embodiments thereof, the foregoing description is intended to illustrate and not limit the scope of the invention. Other aspects, advantages, and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention pertains. [00287] The invention having been described, the following examples are offered to illustrate the subject invention by way of illustration, not by way of limitation. 87 WO 2013/102674 PCT/EP2013/050126 EXAMPLES Example 1 - IDENTIFICATION OF ASPARTIC PROTEASES IN TRICHODERMA REESEI [00288] This example demonstrates the ability of aspartic proteases from Trichoderma reesei (T. reesei) culture supernatants to degrade antibody heavy chains and light chains. Aspartic Protease Purification [00289] It was found that protease activity in T. reesei supernatants could be inhibited with the aspartic protease inhibitor pepstatin A. Therefore, pepstatin A (Sigma #P2032) was attached to agarose beads via a diaminodipropylamine linker, and was used as an affinity resin for purification. The T. reesei fed batch fermentation supernatant (15 ml) was used to batch bind proteases to the resin in 35 ml of buffer containing 50 mM sodium acetate, 0.2 M NaCl, pH 3.0. The column was washed with the same binding buffer and bound protein was removed with elution buffer (50 mM Tris-HCL, 1 M NaCl, pH 8.5). Fractions of 0.5 ml were collected. In total 42 p g of protease was purified. The peak fraction contained 0.04 Pg/P I protein. 30 P1I of each fraction was mixed with 6 l of Laemmli sample buffer containing 3-mercaptoethanol. The samples were heated at 95'C for 5 minutes before being loaded into a 4-15% PAGE gel (BioRad mini-protean TGX precast gel) along with a broad range prestained molecular weight marker (BioRad). The gel was run in SDS PAGE running buffer for 30 minutes at 100 V, and then stained with GelCode (Thermo Scientific) blue stain. [00290] A 42 kD doublet band was purified in the pepstatin A affinity column (Fig. 1), and was excised from the SDS PAGE gel and subjected to in-gel trypsin digestion with sequencing grade modified trypsin (Promega #V5 111). The resulting peptides were then extracted from the gel and purified by C18 ZipTip (Millipore #ZTC18M096). The purified peptides were analyzed by LC-MS/MS on a QSTAR Pulsar, ESI-hybrid quadrupole-TOF (AB Sciex). [00291] This analysis resulted in the identification of 4 aspartic proteases that have very similar molecular weights. The identified proteases included: pep] (Tre74156; 42.7 kD, 42% sequence coverage), pep2 (Tre53961; 42.4 kD, 15% sequence coverage), pep3 (Tre121133; 49 88 WO 2013/102674 PCT/EP2013/050126 kD, 6% sequence coverage), and pep5 (Tre81004; 45 kD, 9% sequence coverage). These aspartic proteases ran at a similar molecular weight in the PAGE gel. Their amino acid sequence similarity is between 51%-64%. [00292] Protein (0.8 pg) from the peak fraction (F3) was then incubated with IgG (50 Pg/ml) in sodium citrate buffer (50 mM, pH 5.5) at 37'C for 20 hours (Fig. 2). The protein was incubated either in the presence or absence of 10 p M pepstatin A. The antibody mixture was combined with Laemmli sample buffer and heated at 95'C for 5 minutes. These samples were then loaded into a 4-15% PAGE gel (BioRad mini-protean TGX precast gel) along with a broad range prestained molecular weight marker (BioRad). The gel was run in SDS PAGE running buffer for 30 minutes at 100 V. The IgG was not reduced before being run on the gel. Full size IgG runs just above the 200 kDa marker. As can be seen in the nonreducing gel in Figure 2, the aspartic proteases were able to produce mild degradation of the IgG. Moreover, IgG degradation was inhibited by pepstatin A. The aspartic protease activity was more limited at pH 5.5 than at acidic pHs, where they had maximal activity. Analysis of pep] Deletion [00293] The aspartic protease pep] protease was then tested to determine its abundance in T. reesei. This was performed by purifying aspartic proteases from supernatant samples derived from the pep] deletion strain M1 82. The M1 82 pep] deletion strain also produces the rituximab antibody. [00294] The M181 pep] deletion strain made in the base strain M124 was grown in large shake flask cultures along with M124 control flasks. The cultures were grown in 300 ml of TrMM with 4 g/L lactose, 2 g/L spent grain extract, and 100 mM PIPPS, pH 5.5. Three different model antibodies were incubated (0.05 pg/p I final concentration) in the shake flask culture supernatants (diluted 2 mg/ml in sodium citrate buffer pH 5.5) of the pep] deletion strain and its parental strain M124, and as a comparison in a fermentation culture supernatant of the parental strain. Supernatant samples (30 pl) from day 5 cultures containing antibody were loaded into a 4-15% SDS PAGE gel and transferred to nitrocellulose for immunoblotting with an anti-heavy 89 WO 2013/102674 PCT/EP2013/050126 chain AP conjugated antibody (Sigma #A3188) or anti-light chain antibody AP conjugate (Sigma #A3813) diluted 1:30,000 in TBST. When incubated with antibody overnight for 18 hours, the Apep] supernatant degraded less of the heavy chain protein as compared to the M124 control strain or fermentation supernatant (pH 5,5; 28'C; 20 g/L spent grain extract, 60 g/L lactose) (Fig. 39). The heavy chain was more susceptible to degradation as compared to the light chain. The biggest stabilization effect was evident for rituximab and MABO heavy chains. In the heavy chain, two distinct degradation products can be seen -48 kD and -38 kD (Fig. 39). There was only a slight improvement in the stability of light chain protein in the ApepI supernatant as compared to controls (Figure 39). Generation of pep] deletion plasmid [00295] The first deletion construct for pep] (TreID74156), was designed to enable removal of the selection marker from the Trichoderma reesei genome after successful integration and thereby recycling of the selection marker for subsequent protease gene deletions. In this approach, the recycling of the marker, i.e. removal of pyr4 gene from the deletion construct, resembles so called blaster cassettes developed for yeasts (Hartl, L. and Seiboth, B., 2005, Curr Genet 48:204-211; and Alani, E. et al., 1987, Genetics 116:541-545). Similar blaster cassettes have also been developed for filamentous fungi including Hypocrea jecorina (anamorph: T. reesei) (Hartl, L. and Seiboth, B., 2005, Curr Genet 48:204-211). [00296] The TreID number refers to the identification number of a particular protease gene from the Joint Genome Institute Trichoderma reesei v2.0 genome database. Primers for construction of deletion plasmids were designed either "by eye" or using Primer3 software (Primer3 website, Rozen and Skaletsky (2000) Bioinformatics Methods and Protocols: Methods in Molecular Biology. Humana Press, Totowa, NJ, pp 365-386). [00297] The principle of the blaster cassette using pyr4 as the marker gene is as follows: pyr4, encoding orotidine-5'-monophosphate (OMP) decarboxylase of T. reesei (Smith, J.L., et al., 1991, Current Genetics 19:27-33) is needed for uridine synthesis. Strains deficient for OMP decarboxylase activity are unable to grow on minimal medium without uridine supplementation 90 WO 2013/102674 PCT/EP2013/050126 (i.e. are uridine auxotrophs). The utilisation of 5-fluoroorotic acid (5-FOA) in generation of mutant strains lacking OMP decarboxylase activity (pyr4 strains) is based on the conversion of 5-FOA to a toxic intermediate 5-fluoro-UMP by OMP decarboxylase. Therefore, cells which have a mutated pyr4 gene are resistant to 5-FOA, but in addition are also auxotrophic for uridine. The 5-FOA resistance can in principle result also from a mutation in another gene (pyr2, orotate phosphoribosyltransferase), and therefore the spontaneous mutants obtained with this selection need to be verified for the pyr4- genotype by complementing the mutant with the pyr4 gene. Once mutated, the pyr4 gene can be used as an auxotrophic selection marker in T. reesei. In our blaster cassette pyr4 is followed by a 308 bp direct repeat of pyr4 5' untranslated region (5'UTR) and surrounded by 5' and 3' flanking regions of the gene to be deleted. Integration of the deletion cassette is selected via the pyr4 function. Removal of the pyr4 marker is then forced in the presence of 5-FOA by recombination between the two homologous regions (direct repeat of 5'UTR) resulting in looping out of the selection marker and enabling the utilisation of the same blaster cassette (pyr4 loopout) in successive rounds of gene deletions. After looping out only the 308 bp sequence of 5'UTR remains in the locus. [00298] Thus, the pyr4 selection marker and the 5' direct repeat fragment (308 bp of pyr4 5'UTR) were produced by PCR using plasmid pARO502 (containing a genomic copy of T. reesei pyr4) as a template. PCR amplification was performed with Phusion polymerase and either HF buffer or GC buffer, or with Dynazyme EXT polymerase. The reaction conditions varied based on the fragment being amplified. Both fragments contained 40 bp overlapping sequences needed to clone the plasmid with the loopout cassette using homologous recombination in yeast (see below). To enable possible additional cloning steps, an AscI digestion site was placed between the pyr4 marker and the 5' direct repeat and Nod sites to surround the complete blaster cassette. [00299] 1066 bp of 5' flanking region and 1037 bp of 3' flanking region were selected as the basis of the pep] deletion plasmid. Fragments were produced by PCR. Products were separated with agarose gel electrophoresis and correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. Template DNA used in the amplification of the flanking regions was from the T. reesei wild type strain QM6a (ATCC13631). 91 WO 2013/102674 PCT/EP2013/050126 [00300] For the yeast homologous recombination system used in cloning, overlapping sequences for the vector and the selection marker were placed to the appropriate PCR-primers. To enable marker switch in the construct, NotI restriction sites were introduced between the flanking regions and the selection marker. PmeI restriction sites were placed between the vector and the flanking regions for removal of vector sequence prior to transformation into T. reesei. Vector backbone pRS426 was digested with restriction enzymes (EcoRI and XhoI). The restriction fragments were then separated with agarose gel electrophoresis, and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. [00301] To construct the deletion plasmid, the vector backbone and the appropriate marker and flanking region fragments were transformed into Saccharomyces cerevisiae (strain H3488/FY834). The yeast transformation protocol was based on the method for homologous yeast recombination described in the Neurospora knockouts workshop material of Colot and Collopy, (Dartmouth Neurospora genome protocols website), and the Gietz laboratory protocol (University of Manitoba, Gietz laboratory website). The plasmid DNA from the yeast transformants was rescued by transformation into Escherichia coli. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct recombination using standard laboratory methods. A few clones with correct insert sizes were sequenced and stored. [00302] The first deletion plasmid for pep] (plasmid pTTv41, Table 1.1) used another selection marker, bar, a synthetic construct carrying a phosphinothricin N-acetyltransferase of Streptomyces ssp (GenBank ID: AF013602.1, Sweigard et al, 1997, Fungal Genet Newsl 44:52 53). The flanking region and marker fragments were produced by PCR and assembled to a plasmid using the yeast recombination method described above. To clone the second pep] deletion plasmid (pTTv71, Table 1.1), the bar marker was removed from the deletion plasmid pTTv41 with NotI digestion and replaced by the pyr4 blaster cassette described above using the yeast homologous recombination system. These deletion plasmids for pep] (pTTv41 and pTTv7 1) result in 1874 bp deletion in the pep] locus and cover the complete coding sequence of PEP1. 92 WO 2013/102674 PCT/EP2013/050126 Table 1.1: Primers for generating pep1 deletion plasmids. Deletion plasmid pTTv4l for pep1 (TreID74156), vector backbone pRS426 Primer Sequence 5flankfw GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACGTATTGCGATGAGCAGC AGA (SEQ ID NO: 243) 5flankrev ATCCACTTAACGTTACTGAAATCTGGTCTCCTAACCCACCAAG (SEQ ID NO: 244) 3flankfw CTCCTTCAATATCATCTTCTGTCTGTGAAATGAGGTCCCTTCC (SEQ ID NO: 245) 3flankrev GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACCAAACGCAGCAGAAAC CATA (SEQ ID NO: 246) PTfwd GATTTCAGTAACGTTAAGTGGATGCGGCCGCGACAGAAGATGATATTGAAG (SEQ ID NO: 247) PTrev GACAGAAGATGATATTGAAGGAGGCGGCCGCTTAAGTGGATCCCGGTGAC (SEQ ID NO: 248) Deletion plasmid pTTv7l for pep1 (TreID74156), vector backbone pTTv4l Primer Sequence T315_pyr4jor GGTGGGTTAGGAGACCAGATTTCAGTAACGTTAAGTGGATGCGGCCGCCTAGC ATCGACTACTGCTGC (SEQ ID NO: 249) T316_pyr4_rev GCAGCAGTAGTCGATGCTAGGCGCGCCATGCAAAGATACACATCAA (SEQ ID NO: 250) T317_pyr4loopfor TTGATGTGTATCTTTGCATGGCGCGCCTAGCATCGACTACTGCTGC (SEQ ID NO: 251) T318_pyr4jooprev AGGGACCTCATTTCACAGACAGAAGATGATATTGAAGGAGGCGGCCGCGGCTG ATGAGGCTGAGAGAG (SEQ ID NO: 252) Generation of pep] deletion strains M181 and M195 [00303] To enable recycling of the selection marker and allow rapid deletion of subsequent protease genes, pep] was deleted from M127 (pyr4- mutant of the basic strain M124) using the pyr4 blaster cassette described above. To remove the vector sequence, plasmid pTTv71 (Apepl pyr4) was digested with PmeI and the correct fragment was purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the pep] deletion cassette was used to transform strain M127. Preparation of protoplasts and transformation for pyr4 selection were carried out essentially according to methods in Penttila et al. (1987, Gene 61:155-164) and Gruber et al (1990, Curr. Genet. 18:71-76). [00304] 200 clones were picked as selective streaks. 24 transformants growing fast as selective streaks were screened by PCR using the primers listed in Table 1.2 for the correct integration using standard laboratory methods. Seven putative disruptants were purified to single cell clones. 93 WO 2013/102674 PCT/EP2013/050126 Deletion of pep] was verified by Southern analyses from these clones (Fig. 3A) using standard laboratory methods. DNA for Southern analyses was extracted with Easy-DNA kit for genomic DNA isolation (Invitrogen). Southern analyses were essentially performed according to the protocol for homologous hybridizations in Sambrook et al. (1989, Molecular Cloning: A laboratory manual. 2 Ed., Cold Spring Harbor Laboratory Press) using radioactive labeling (32P), HexaLabel Plus, or DecaLabel Plus kits (Fermentas). Southern digestion schemes were designed using either Sci Ed Central for Windows 95 (Clone Manager 5 for Windows 95) or Geneious Pro 5.3.6 software, (Geneious website). Southern analyses also verified that four of the clones were single integrants (Figs. 3B and 3C). Three clones indicated multiple or inaccurate integration of the deletion cassette and were discarded. Two pure clones were designated with strain numbers M181 (9-20A-1) and M195 (9-35A-1). Generation of rituximab producing pep] deletion strain M182 [00305] To remove vector sequence, plasmid pTTv41 (Apepl-bar) was digested with PmeI and the correct fragment was purified from agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the pep] deletion cassette was used to transform strain M169 (expressing harmonized rituximab antibody). Preparation of protoplasts and transformation were carried out according to methods described in Penttila et al (1987) and Avalos et al. (1989). [00306] Approximately 100 clones were picked as selective streaks. 24 transformants growing fast as selective streaks were screened by PCR (using the primers listed in Table 1.2) for the correct integration using standard laboratory methods. Eight putative disruptants were purified to single cell clones. Deletion of pep] was verified by Southern analyses from five clones (Fig. 4A) using standard laboratory methods described above for M181 and M195. Southern analyses also verified that four of the clones were single integrants (Figs. 4B and 4C). One clone indicated multiple or inaccurate integration of the deletion cassette and was discarded. One pure clone (11 1A) was designated with strain number M182. Table 1.2: Primers for screening integration of pep1 deletion constructs. For screening integration of pTTv4l Primer Sequence 94 WO 2013/102674 PCT/EP2013/050126 T075_74156_5int TCGCTGTAACGAACTTCTGT (SEQ ID NO: 253) T032_Bar-loppufor CATTGTTGACCTCCACTAGC (SEQ ID NO: 254) T076_74156_3int GCTGCTGATCGGACATTTTT (SEQ ID NO: 255) T031_Baralkurev2 GTTTCTGGCAGCTGGACT (SEQ ID NO: 256) For screening integration of pTTv7l Primer Sequence T075_74156_5int TCGCTGTAACGAACTTCTGT (SEQ ID NO: 257) T027_Pyr4_orf startrev TGCGTCGCCGTCTCGCTCCT (SEQ ID NO: 258) For screening deletion of pep1 ORF Primer Sequence T077_74156_5orf_pcr CGACGATCTACAGCCATCTG (SEQ ID NO: 259) T078_74156_3orf_pcr ACCCAAAGCGTCCTTCATTA (SEQ ID NO: 260) Analysis of rituximab producing pep] deletion strain M1 82 [00307] The M182 strain was grown in Trichoderma minimal medium (TrMM) supplemented with 20 g/l spent grain extract, 60 g/l lactose, and 8.1 g/l casamino acids at pH 5.5 and 28'C. Seven microgram of aspartic protease was recovered from 15 ml of supernatant. When the purified fractions were run on a 4-15% SDS PAGE gel (BioRad mini-protean TGX precast gel), the 42 kD molecular weight band previously seen in the parent strain had disappeared (Fig. 5). Only a faint band around 40 kD could be seen. The 40 kD band may correspond to minor aspartic proteases. A second purification was done from a cultivation supernatant where pep] was present. The M169 strain produced rituximab and did not contain a pep] protease deletion. The strain was grown in Trichoderma minimal medium supplemented with 20 g/l spent grain extract, 60 g/l lactose, and 8.1 g/l casamino acids at pH 5.5 and 28'C. 17 pg of aspartic protease were purified from 15 ml of supernatant, and showed a 42 kD band on the SDS PAGE gel (Fig. 5). According to this analysis, approximately 10 p g of pep] protease is produced per 15 ml of culture supernatant. That is about 60% of the total aspartic protease and only about 0.04% of total protein content in the supernatant. This data demonstrates that pep] is the most abundant aspartic protease in T. reesei. Analaysis of other aspartic proteases 95 WO 2013/102674 PCT/EP2013/050126 [00308] Deletion of pep2 showed only a slight improvement in antibody heavy chain production and reduced total protease activity (Figs. 6 and 7). [00309] Therefore, pep3 and pep5 were the next important proteases to be deleted especially in a pep1Itsp1lslp1 triple deletion strain, as they still contribute up to half of the remaining protease activity in a triple deletion strain supernatant. Generation of pep2 deletion plasmid [00310] The pTTv96 deletion plasmid for the aspartic protease pep2 (TreID0053961) was constructed essentially as described for the pTTv41 pep] deletion plasmid above. 920 bp of 5' flanking region and 1081 bp of 3' flanking region were selected as the basis of the pep2 deletion plasmid. Flanking region fragments were produced by PCR using the primers listed in Table 1.3. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. Template DNA used in the PCR of the flanking regions was from the T. reesei wild type strain QM6a. The bar cassette was obtained from pTTv41 with NotI digestion. The vector backbone was EcoRI/XhoI digested pRS426 as for pTTv41 above. The plasmid was constructed using the yeast homologous recombination method described for pTTv41 above. This deletion plasmid for pep2 (pTTv96) results in a 1437 bp deletion in the pep2 locus and covers the complete coding sequence of PEP2. Table 1.3: Primers for generating pep2 deletion plasmid. Primer Sequence 5'flank fwvector GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACTTCAGTTGTGGCA TCTCAGC (SEQ ID NO: 261) 5'flank revmarker GCCAAGCCCAAAAAGTGCTCCTTCAATATCATCTTCTGTCGCGGCCGCGG cassette promoter GAAGCAAGTTTCGAAGTG (SEQ ID NO: 262) 3'flank fwmarker CCCGTCACCGAGATCTGATCCGTCACCGGGATCCACTTAAGCGGCCGCA cassette end ATGGATGAGGTGTGGCTTC (SEQ ID NO: 263) 3'flank revvector GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACTCCTCACCGAAG AGCAAGTC (SEQ ID NO: 264) Generation of rituximab producing pep2 deletion strain M455 96 WO 2013/102674 PCT/EP2013/050126 [00311] To remove vector sequence, plasmid pTTv96 (Apep2-bar) was digested with PmeI and the correct fragment was purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 6 tg of the pep2 deletion cassette was used to transform strain M169 (expressing harmonized rituximab antibody). Preparation of protoplasts and transformation were carried out as described for M182 above using bar selection. [00312] Over 200 clones were picked as selective streaks. 29 transformants grew well as second streaks. The best 10 transformants growing fast as selective streaks were screened for the correct integration by PCR, using the primers listed in Table 1.4, using standard laboratory methods. The deletion cassette was integrated properly in 9 of the 10 clones analyzed. The open reading frame was deleted in 9 of the 10 transformants analyzed by PCR. Five disruptants were purified to single cell clones. One pure transformant (206A) was designated with strain number M455. Table 1.4: Primers for screening integration of pep2 deletion constructs. For screening integration of pTTv96 Primer Sequence 5'flank fwvector GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACTTCAGTTGTGGCA TCTCAGC (SEQ ID NO: 265) T032_Bar-loppu-for CATTGTTGACCTCCACTAGC (SEQ ID NO: 266) T030_Baralkurev CGTCACCGAGATCTGATCC (SEQ ID NO: 267) 3'flank revvector GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACTCCTCACCGAAG AGCAAGTC (SEQ ID NO: 268) For screening deletion of pep2 ORF Primer Sequence T601_pep2 fwd GACGTGGTACGACAACATCG (SEQ ID NO: 269) T623_pep2 rev TATCAAGGTACCGGGGACAG (SEQ ID NO: 270) Analysis of rituximab producing pep2 deletion strain [00313] The M455 strain, 4 other pep2 deletion transformants, and the parental rituximab production strain M169 were grown in shake flask cultures in Trichoderma minimal medium (TrMM) supplemented with 20 g/l spent grain extract, 40 g/l lactose, 100 mM PIPPS, and 8.1 g/l casamino acids at pH 5.5 and 28'C. To analyze the effect on rituximab production, 30 l of 97 WO 2013/102674 PCT/EP2013/050126 supernatant from the day 5 culture samples was subjected to immunoblotting. The heavy chain was detected with the anti-heavy chain AP conjugated antibody (Sigma #A3188) diluted 1:10,000 in TBST. The light chain was detected with the anti-kappa light chain AP conjugated antibody (Sigma #A3813). A slight improvement in heavy chain production was seen in transformant 206A (Fig. 6). The heavy chain was fragmented, but the full length and the 38 kD fragment were slightly improved over the parental stain. Additionally, total protease activity was measured with succinylated casein (QuantiCleave protease assay kit, Pierce #23263) according to the manufacturer's protocol. Transformant 206A/M455 showed the biggest decrease in protease activity compared to the parent strain M169 activity (Fig. 7). The total protease activity in the supernatant was reduced by 10% for M455. Analysis of Pichia-expressed aspartic proteases [00314] The T. reesei aspartic proteases pep3 (tre121133) and pep7 (tre58669) expressed from Pichia were also tested in vitro, by measuring the degradation of the MABO antibody and IGF 1. Degradation of MABO and IGF-1 bypep3 and pep7 was analyzed by immunoblotting. The aspartic proteases were produced in Pichia supernatants. Pichia supernatants were diluted to 1x concentration, and then mixed with 50 mM sodium citrate buffer, pH 5.5. MABO was added to each reaction so that the final concentration would be 0.05 pg/ 1. IGF-1 was added to each reaction so that the final concentration would be 0.30 pg/ 1. Ten microliters of each reaction mixture was then sampled and added to 3 l of Laemmli sample buffer with p-mercaptoethanol. The samples were heated at 95'C for 5 minutes before being loaded into a 4-15% PAGE gel (BioRad mini-protean TGX precast gel) along with an all blue precision plus prestained molecular weight marker (BioRad). The PAGE gel was run for 30 minutes at 200V. The proteins in the gel were then electrotransferred into a nitrocellulose filter at 1 00V for 1 hour. The protein containing nitrocellulose filter was then blocked with 5% milk powder in Tris buffered saline with 0.1% tween (TBST) for 1 hour shaking at room temperature. The blocked membranes were then probed with antibody. The MABO containing membranes were probed with an anti-IgG heavy chain antibody AP conjugate (Sigma #A3188) diluted 1:30,000 in TBST. The IGF-1 samples were analyzed using a primary anti-IGF-1 antibody (1:2000 in TBST) and anti-IgG AP conjugated secondary antibody (1:5000 in TBST). All antibody incubations were done for 1 hour 98 WO 2013/102674 PCT/EP2013/050126 at room temperature on a shaker. The membranes were then washed with 3 changes of TBST for 20 minutes each on the shaker. The membranes were developed with the BCIP/NBT alkaline phosphatase substrate (Promega #S3771) for up to 5 minutes. As shown in Figure 8, the pep3 protease had low MABO degrading activity at pH 5.5 after overnight incubation at 37'C, but the activity was higher at pH 4.5. The pep7 protease only had minimal antibody degrading activity at pH 4.5. Isolation of Additional Aspartic Proteases Using SIP Peptide [00315] Several additional aspartic proteases were isolated from the T. reesei M277 triple protease deletion strain (pep], tsp], sip]). The M277 strain does not express heterologous proteins. The M277 deletion strain was generated as described in Example 4 below. The strain was grown in Trichoderma minimal medium supplemented with 20 g/l spent grain extract, 60 g/l lactose, and 9 g/l casamino acids at pH 5.5 and 28'C. The aspartic proteases were isolated by affinity purification using the SIP peptide (Ac-Phe-Lys-Phe-(AHPPA)-Leu-Arg-NH 2 ) (Kataoka Y. et al. 2005 FEBS Letters 579, pp 2991-2994). The SIP peptide was conjugated to NHS activated agarose resin (Pierce #26196) using the protocol provided by the manufacturer. The SIP affinity resin was used to purify proteases. Fermentation supernatant (15 ml) from the T. reesei M277 strain was then used to batch bind proteases to the resin in 35 ml buffer containing 50 mM sodium acetate, 0.2 M NaCl, pH 3.0 (from fermentation conditions pH 5,5; 28'C; 9 g/l casaminoacids; 20 g/L spent grain extract, 60 g/L lactose). The column was washed with the same binding buffer and bound protein removed with elution buffer (50 mM Tris-HCL, 1 M NaCl, pH 8.5). Fractions of 0.5 ml were then collected. [00316] 30 l of each purified fraction was then run on a 4-15% SDS PAGE gel (BioRad mini-protean TGX precast gel) and stained overnight with GelCode blue (Thermo Scientific). The SDS PAGE gel showed predominate bands around 42 kDa and a faint band around 25 kD (Fig. 9). The bands from the gel were then cut and subjected to in-gel trypsin digestion with sequencing grade modified trypsin (Promega #V5 111). The resulting peptides were extracted from the gel and purified by C18 ZipTip (Millipore #ZTC18M096). The purified peptides were analyzed by LC-MS/MS on a QSTAR Pulsar, ESI-hybrid quadrupole-TOF (AB Sciex). This 99 WO 2013/102674 PCT/EP2013/050126 analysis revealed that PEP2, PEP3, PEP4, and PEP5 were present in the sample along with GAPI and SLP2. It is believed that the faint band around 25 kD corresponds to the glutamic protease GAP1. [00317] The SIP purified proteases were then tested for their ability to degrade the MABO antibody heavy chain. The purified SIP proteases were incubated overnight with MABO at a final concentration of 0.05 pg/pl in sodium citrate buffer at 37 0 C. The samples were incubated at pH 4.0 and pH 5.5 and both in the presence and absence of an SIP inhibitor peptide. The reactions were sampled after. The collected samples were analyzed by immunoblotting with an anti-IgG heavy chain antibody AP conjugate (Sigma A3188) diluted 1:30,000 in TBST. The results of the immunoblot showed that the proteases had high protease activity against the MABO heavy chain when incubated at pH 4.0, and reduced activity at pH 5.5 (Fig. 10). Additionally, both aspartic and glutamic protease activities were inhibited by incubation with the SIP peptide (Fig. 10). Analysis of SIP-purified aspartic proteases [00318] Protease activity was then tested against casein both in the presence and absence of protease inhibitors. Protease activity against casein was tested using the EnzChek protease assay kit (Molecular probes #E6638, green fluorescent casein substrate). The working stock solution was prepared by diluting the stock to 10 pg/ml in 50 mM sodium citrate, pH 5.5. The purified protease fractions (10 p l) were diluted with 40 p1I of sodium citrate, pH 5.5. 100 p1I of the diluted substrate was combined with the diluted protease fractions in a 96 well sample plate. The plate was then covered and kept at 37'C for one to three hours. Fluorescence readings were taken at one, two, and three hours with a Varioskan fluorescent plate reader (Thermo Scientific) using 485 nm excitation and 530 nm emission. [00319] The SIP inhibitor peptide, pepstatin A, LIP peptide, SBTI, and chymostatin were used as inhibitors. The SIP inhibitor peptide inhibited both aspartic and glutamic proteases; pepstatin A inhibited only aspartic proteases; LIP peptide only inhibited glutamic protease; SBTI was able to inhibit SLP2 and PEP4, and chymostatin inhibited SLP2. SIP, LIP, and pepstatin A were used 100 WO 2013/102674 PCT/EP2013/050126 at a concentration of 60 PM, and SBTI was used at a concentration of 200 Pg/ml. To differentiate between the aspartic and glutamic proteases, pepstatin A was used as inhibitors, as it does not inhibit glutamic proteases. [00320] When casein digestion was studied, a large portion of the SIP protease activity was inhibited by pepstatin A (Fig. 11). The results from casein degradation studies suggested that a large part of the activity at pH 5.5 in the purified fractions comes from aspartic proteases. The LIP peptide, which is the GAPI propeptide, inhibited the protease activity slightly less compared to SIP inhibitor. The SBTI and chymostatin were able to inhibit the SLP2 protease in the purified sample. [00321] These results support the conclusion that there are 4 aspartic proteases present in the SIP fraction (PEP2, PEP3, PEP4, and PEP5). EXAMPLE 2 - IDENTIFICATION OF GLUTAMIC PROTEASES [00322] This example demonstrates the ability of glutamic proteases from Trichoderma reesei (T. reesei) culture supernatants to degrade antibody heavy chains and light chains. Analysis of gap] Deletion [00323] It has been previously determined that there are four glutamic protease sequences in the T. reesei genome. The most abundant glutamic protease is gap] (tre69555), as determined by transcriptional profiling. Accordingly, the gap] protease was purified from T. reesei supernatant from SIP peptide affinity chromatography, as described Example 1. [00324] A gap] deletion was then generated using the T. reesei MABOantibody production strain M244 (Apep1). Generation of gap] deletion plasmid [00325] The deletion pTTv1 l7plasmid for the glutamic protease gap] (TreID69555) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. 1000 bp of 5' flanking region and 1100 bp of 3' flanking region were selected as the basis of the gap] 101 WO 2013/102674 PCT/EP2013/050126 deletion plasmid. Flanking region fragments were produced by PCR using the primers listed in Table 2.1. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. Template DNA used in the PCR of the flanking regions was from the T. reesei wild type strain QM6a. The pyr4 blaster cassette was obtained from pTTv71 with NotI digestion. The vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for gap] (pTTv1 17) resulted in a 1037 bp deletion in the gap] locus and covers the complete coding sequence of GAP1. Table 2.1: Primers for generating gap1 deletion plasmid. Deletion plasmid pTTvl17 for gap1 (TreID69555), vector backbone pRS426 Primer Sequence JJ-045 primer GATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAAC ACCTCATGAGGGACTATGG (SEQ ID NO: 271) JJ-046 primer GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCGGCCG CCAAGAAGAGGCAGAGGGTAAT (SEQ ID NO: 272) JJ-047 primer CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGGCCGC CTATACATACTGATGATACA (SEQ ID NO: 273) JJ-048 primer TGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCGTTTAAA CGCCCCATGTATGGACTCTAC (SEQ ID NO: 274) Generation of MABO producing Apep1Agap] double deletion strain M296 [00326] To generate the MABO antibody producing strain for the second protease deletions, the pep] deletion strain M181 (Example 1) was transformed with MAB01 light and heavy chain constructs (pTTv98+pTTv67) using hygromycin and acetamide in selection. This MABO strain with the pep] deletion was designated with number M244. The removal of the pyr4 blaster cassette from pep] locus was carried out essentially as described in Example 3 below for M195 (in generation of double protease deletion strain M219). This pyr4- strain was designated with number M285 and used as the parent for the subsequent protease deletion. [00327] To remove vector sequence, plasmid pTTv 117 (Agap]-pyr4) was digested with PmeI and the correct fragment purified from an agarose gel using QlAquick Gel Extraction Kit 102 WO 2013/102674 PCT/EP2013/050126 (Qiagen). Approximately 5 tg of the gap] deletion cassette was used to transform strain M285 (pyr4- of MABO antibody strain M244, based on Apep] strain M181). Preparation of protoplasts and transformation were carried out using pyr4 selection essentially as described for the pep] deletion strains M181 and M195 in Example 1. [00328] Colonies from the transformation plates were picked as selective streaks. Clones growing fast as selective streaks were screened by PCR using the primers listed in Table 2.2 for the correct integration using standard laboratory methods. Putative disruptants were purified to single cell clones. Table 2.2: Primers for screening gap1 integration and strain purity. For screening integration of pTTv117 Primer Sequence T052_gapl5screenF CTCAGAAAGGTTGTAGTTGTGA (SEQ ID NO: 275) T026_Pyr4_orf 5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 276) T053_gap1_3screenR GATGTTGTGTTTTCAGTCTGCA (SEQ ID NO: 277) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 278) For screening deletion of gap1 ORF T109_gaplORFF ATGTTCATCGCTGGCGTCG (SEQ ID NO: 279) Ti10_gap1_ORFR CTAAACGTAAGAGCAGGTCAA (SEQ ID NO: 280) Analysis of MABO] producing ApepAgap] double deletion strain [00329] The double deletion strain (Apep1Agap]) was grown in a 2 litre shake flask culture containing 300 ml of Trichoderma minimal medium supplemented with 40 g/l lactose, 20 g/l spent grain extract, and 9 g/l casamino acids and buffered to pH 5.5 with 100 mM PIPPS. The Agap] strain was then tested for MABO heavy chain and light chain production (Fig. 12). The Agap] strain was compared to strains having deletions in each of slp], slp2, and slp3. The Apep] strain M244 was used as a control. Samples were from day 7 large shake flask cultures. Samples were analyzed via immunoblotting with anti-IgG heavy chain (Sigma #A3188) or anti-light chain (Sigma #A3812) antibody AP conjugate (Fig. 12). The gap] deletion resulted in a 2-fold improvement in heavy chain production and a 1.6-fold improvement in light chain production as compared to the M244 control strain (Fig. 13). 103 WO 2013/102674 PCT/EP2013/050126 Analysis of gap2 Deletion [00330] Based upon transcriptional profiling data generated from the M194 Trichoderma reesei strain , the second most abundant glutamic protease was identified as gap2 (tre106661). Thus, the gap2 protease was also deleted from the M244 (Apep1) strain using the pTTV145 deletion construct. Generation of gap2 deletion plasmid [00331] The pTTv145deletion plasmid for the glutamic protease gap2 (TreID106661) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. 1021 bp of 5' flanking region and 1010 bp of 3' flanking region were selected as the basis of the gap2 deletion plasmid. In this plasmid the direct repeat fragment of the pyr4 blaster cassette was changed from pyr4 5'UTR to 320 bp direct repeat from the end of gap2 5' flanking region and no AscI site was added between the pyr4 and the 5' direct repeat. This type of blaster cassette should not leave any additional sequence to the locus of the deleted gene after excision. Fragments were produced by PCR using the primers listed in Table 2.3. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. Template DNA used in the PCR of the flanking regions was the T. reesei wild type strain QM6a. The pyr4 marker gene was obtained from pHHO5 with NotI digestion. The vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for gap2 (pTTv145) results in a 944 bp deletion in the gap2 locus and covers the complete coding sequence of GAP2. Table 2.3: Primers for generating gap2 deletion plasmid. Deletion plasmid pTTvl45 for gap2 (TreID106661), vector backbone pRS426 Primer Sequence T11_gap2_5flankFpRS426 GATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGGTT TAAACGCTACTACGCGAGCAAGTG (SEQ ID NO: 281) T102_gap2_5flankR-pyr4 GGAACTGTCGGCGATTGGGAGAATTTCGTGCGATCGCGGCGGC CGCCGGATGAAGATGTGCAGTTG (SEQ ID NO: 282) T103gap2-loopFpyr4 AGGGAACATATCACCCTCGGGCATTTTTCATTTGGTAGGCGGC CGCTAAGATATCTTCAAGCTTATGCG (SEQ ID NO: 283) 104 WO 2013/102674 PCT/EP2013/050126 T104gap2-loopR CGGATGAAGATGTGCAGTTG (SEQ ID NO: 284) T105gap2_3flankFloop TGTCTCACTTCCACCCATCTCAACTGCACATCTTCATCCGAGCA ACAACATGAGGTTCGAA (SEQ ID NO: 285) T106_gap2_3flankR-pRS426 CCTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACAGTTT AAACACAACGCATGTCCAGCTTTTG (SEQ ID NO: 286) Generation of MABO producing ApeplAgap2 double deletion strains M360 [00332] To generate the MABO antibody producing strain for the second protease deletions, the pep] deletion strain M181 (Example 1) was transformed with MAB01 light and heavy chain constructs (pTTv98+pTTv67) using hygromycin and acetamide in selection. The removal of the pyr4 blaster cassette from pep] locus was carried out essentially as described in Example 3 below for M195 (in generation of double protease deletion strain M219). This pyr4- strain was designated with number M285 and used as the parent for the subsequent protease deletion. [00333] To remove vector sequence, plasmid pTTv145 (Agap2-pyr4) was digested with PmeI and the correct fragment purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the gap2 deletion cassette was used to transform strain M285 (pyr4- of MABO antibody strain M244, based on Apep] strain M181). Preparation of protoplasts and transformation were carried out using pyr4 selection essentially as described for the strains M181 and M195 in Example 1. [00334] Colonies from the transformation plates were picked as selective streaks. Clones growing fast as selective streaks were screened by PCR using the primers listed in Table 2.4 for the correct integration using standard laboratory methods. Putative disruptants were purified to single cell clones. Table 2.4: Primers for screening gap2 integration and strain purity. For screening integration of pTTv145 Primer Sequence T048_gap2_5screenF GCTTGGCATCACGGAAGCT (SEQ ID NO: 287) T026_Pyr4 orf 5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 288) T049_gap2_3screen R TTGACAAGAAAGGTCCGGTTG (SEQ ID NO: 289) T028_Pyr4 flankrev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 290) 105 WO 2013/102674 PCT/EP2013/050126 For screening deletion of gap2 ORF T107_gap2_ORFF ATGGATGCTATCCGAGCCAG (SEQ ID NO: 291) T108_gap2_ORFR CTATTCATACTCAACAGTCACA (SEQ ID NO: 292) Analysis of MAB01 producing Apep1Agap2 double deletion strain [00335] Several deletion transformants were produced. The culture supernatants from these transformants were run on a 4-15% SDS PAGE gel and then the MAB01 antibody heavy chain was analyzed by immunoblotting with an anti-heavy chain AP conjugated antibody (Sigma #A3188), and the light chain was detected with an anti-light chain AP conjugated antibody (Sigma #A3812). The results of the immunoblot show that deleting gap2 resulted in a several fold increase in MABO1 heavy and light chain production (Fig. 14). Analysis of Pichia-expressed gap2 [00336] Pichia supernatants containing Trichoderma reesei gap2 were also studied in vitro. The gap2 containing supernatant and MABO 1 antibody were diluted into sodium citrate buffers adjusted to pH 4.0, 4.5, 5.0, and 5.5, and incubated for 20 hours at 37 0 C. Samples were taken at 0 minutes and after 20 hours. MAB01 heavy chain production was analyzed by immunblotting using an anti-IgG heavy chain (Sigma #A3188) antibody AP conjugate. The results of the immunoblot show that gap2 had maximal proteolytic activity against heavy chain MAB01 at pH 4.0 (Fig. 15). While the gap2 protease activity was low at pH 5.5 (Fig. 15), over 4 days it was able to demonstrate significant activity on the heavy chain. The gap2 protease produced degradation products around 25 kD, indicating that it has proteolytic activity in the heavy chain hinge region. Example 3 - IDENTIFICATION OF SERINE PROTEASES [00337] This example demonstrates the ability of serine proteases from Trichoderma reesei (T. reesei) to degrade antibody heavy chains and light chains. Serine Protease Purification 106 WO 2013/102674 PCT/EP2013/050126 [00338] Serine proteases comprise a major family of proteases that have been identified as antibody degrading enzymes. Accordingly, serine proteases were purified from Trichoderma supernatant. The serine proteases were first affinity purified from fermentation culture supernatants with a p-aminobenzamidine sepharose 4 fast flow resin (GE healthcare # 17-5123 10). 15 ml of the fermentation culture supernatant was batch bound to the resin in 35 ml of binding buffer (0.05 M Tris-HCL, 0.5 M NaCl, pH 7.4). After packing and washing the column with the same binding buffer, the column was eluted with 0.05 M glycine, pH 3.0. The fractions were then neutralized with IM Tris HCL, pH 8.8. [00339] In total 1.7 mg of protein was purified from the affinity column. When the peak fractions were run on a 4-15% SDS-PAGE gel, several major bands (-110 kD, 53 kD, 39 kD, 29 kD) and many more minor bands were seen. The peak fraction protein mixture (F4) was then tested for protease activity by incubated a sample of the F4 with human IgGI in sodium citrate buffer (50 mM, pH 5.5) at 37'C for 20 hours. The samples were incubated both in the presence and absence of the serine protease inhibitor PMSF (5 mM). The incubated samples were then analyzed by immunoblotting with an anti-IgG heavy chain AP conjugate antibody (Sigma #A3188) and an anti-IgG light chain AP conjugate antibody (Sigma #A3812) diluted 1:30,000 in TBST. The results of the immunoblot showed that the F4 purified protein fraction thoroughly degraded the IgG (Fig. 16). Additionally, treatment with PMSF was able to inhibit most of the degradation, indicating that the protease activity in the F4 fraction that was responsible for the IgG degradation was predominantly serine protease activity. [00340] In order to identify which proteins in the purified fractions exhibited protease activity, the peak fractions were run on an IgG (0.5 mg/ml MAB 02) SDS PAGE zymogram gel (12%). The purified fractions and unpurified supernatant samples were run on the zymogram gel under denaturing conditions. After running the gel, the proteins in the gel were renatured by incubating the gel in 1% triton X-100 to remove the SDS. The zymogram gel was then allowed to incubate overnight in reaction buffer (50 mM sodium citrate, pH 5.5) so that the proteases could degrade IgG in the gel. The gel was then stained with GelCode blue to reveal the extent of IgG staining. Active proteases produced a clear band with no staining (Fig. 17). 107 WO 2013/102674 PCT/EP2013/050126 [00341] There were two clear bands visible on the IgG gel zymogram at around 29 kD and 65 kD. However, the band at 29 kD was much more predominant suggesting it may be responsible for most of the serine protease activity in the sample. These bands were the only two visible ones in the unpurified supernatant sample, and were more pronounced in the purified fractions (Fig. 17). When the protease sample was pre-treated with PMSF, a known serine protease inhibitor, the clear white bands appeared grey or were not visible, indicating that the bands correspond to serine protease enzymes (Fig. 17). Identification of the 29 kD Serine Protease TSP1 [00342] From a matched SDS PAGE gel without MAB02, the 29 kD band was cut from the gel and subjected to in-gel trypsin digestion with sequencing grade modified trypsin (Promega #V51 11). In the purified fractions, the 29 kD band was seen as a distinct protein band. This distinct band was then isolated. The resulting peptides were extracted from the gel and purified by C18 ZipTip (Millipore #ZTC18M096). The purified peptides were analyzed by LC-MS/MS on a QSTAR Pulsar, ESI-hybrid quadrupole-TOF (AB Sciex). The resulting mass analysis clearly identified the 29 kD band as the trypsin-like serine protease TSP1 (tre73897, 35% sequence coverage). Analysis of tsp1 deletion [00343] The gene encoding TSP1 (tsp]) was then deleted from the rituximab antibody production strain M169 to create M183 (Atspl). Shake flask cultures were made with M169 and the tsp1 deletion strain transformants to measure the effect on rituximab expression. The cultures were grown in 300 ml of TrMM with 4 g/L lactose, 2 g/L spent grain extract, and 100 mM PIPPS, pH 5.5. Supernatant samples (30 l) from day 5 were loaded into a 4-15% SDS PAGE gel and transferred to nitrocellulose for immunoblotting with an anti-heavy chain AP conjugated antibody (Sigma #A3188) diluted 1:10,000 in TBST. Two tsp] deletion strain transformants showed a clear increase in rituximab heavy chain expression compared to the parent control strain (Fig. 40). 108 WO 2013/102674 PCT/EP2013/050126 [00344] The deletion construct for the first protease gene, pep] (TreID74156), was designed as described above in Example 1. Generation of tsp] deletion plasmids [00345] The deletion plasmids for the alkaline trypsin-like serine protease tsp] (TreID71322/TreID73897, Dienes et al, 2007, Enz Microb Tech 40:1087-1094) were constructed essentially as described for the pep] deletion plasmids in Example 1. 953 bp of 5' flanking region and 926 bp of 3' flanking region were selected as the basis of the tsp] deletion plasmids. As for pep], the first deletion plasmid for tsp] (pTTv42) used bar as the selection marker. The flanking region fragments were produced by PCR using the primers listed in Table 3.1. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. Template DNA used in the PCR of the flanking regions was from the T. reesei wild type strain QM6a. The bar marker was obtained from pTTv41 (Example 1) with NotI digestion. The vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed using the yeast homologous recombination method described in Example 1. [00346] To clone the second tsp] deletion plasmid (pTTv72), the bar marker was removed from the deletion plasmid pTTv42 with NotI digestion. The pyr4 blaster cassette was obtained from pTTv71 (Example 1) with NotI digestion, ligated to NotI cut pTTv42 and transformed into E. coli using standard laboratory methods. A few transformants were cultivated, plasmid DNA isolated and digested to screen for correct ligation and orientation of the pyr4 blaster cassette using standard methods. One clone with correct insert size and orientation was sequenced and stored. These deletion plasmids for tsp] (pTTv42 and pTTv72) result in a 1252 bp deletion in the tsp] locus and cover the complete coding sequence of TSP1. Table 3.1: Primers for generating tsp1 deletion plasmids. Deletion plasmid pTTv42 for tsp1 (TreID71322/TreID73897), vector backbone pRS426 Primer Sequence T303_71322_5f GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACTGCTGTTGCTG TTTGTTGATG (SEQ ID NO: 293) 109 WO 2013/102674 PCT/EP2013/050126 T304_71322_5rpt CCCGTCACCGAGATCTGATCCGTCACCGGGATCCACTTAAGCGGCCGC CTGTGGTGAGATCTCCAGACG (SEQ ID NO: 294) T305_71322_3fpt GCCAAGCCCAAAAAGTGCTCCTTCAATATCATCTTCTGTCGCGGCCGC ACTGTGCCCAACAATAAGCAG (SEQ ID NO: 295) T306_71322_3r GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACCCAAGGCGCT GGCTGTTA (SEQ ID NO: 296) Deletion plasmid pTTv72 for tsp1 (TreID71322/TreID73897), vector backbone pTTv42 Primer Sequence no new primers, pTTv42 digested with NotI and ligated with pyr4-loopout fragment from pTTv7l Generation of pepltspl double deletion strain M219 [00347] To reuse pyr4 as the selection marker, removal of the pyr4 blaster cassette from the pep] deletion strain M195 was carried out. Spores were spread onto minimal medium plates containing 20 g/l glucose, 2 g/l proteose peptone, 1 ml/l Triton X-100, 5 mM uridine and 1.5 g/l 5-FOA, pH 4.8. 5-FOA resistant colonies were picked after 5-7 days to 0.9% NaCl, suspended thoroughly by vortexing and filtrated through a cotton-filled pipette tip. To purify clones to single cell clones, filtrates were spread again onto plates described above. Purified clones were sporulated on plates containing 39 g/l potato dextrose agarose. These clones were tested for uridine auxotrophy by plating spores onto minimal medium plates (20 g/l glucose, 1 mIl/ Triton X-100) where no growth was observed, indicating that the selected clones were pyr4-. All clones were further tested by PCR (using the primers listed in Table 3.2) for the removal of the blaster cassette and were shown to be correct. The clone (9-35A-1A-a) used to generate the double protease deletion strain (M219) was designated with strain number M196 (Apep1, pyr4-). [00348] To remove vector sequence, plasmid pTTv72 (Atspl-pyr4) was digested with PmeI and the correct fragment was purified from an agarose gel using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the tsp] deletion cassette was used to transform M196 (Apep1, pyr4-). Preparation of protoplasts and transformation were carried out using pyr4 selection essentially as described for the pep] deletion strains M181 and M195 in Example 1. [00349] Over 100 colonies were picked and 48 were screened by PCR using the primers listed in Table 3.2 for the correct integration of the deletion cassette and also for the deletion of the tsp] 110 WO 2013/102674 PCT/EP2013/050126 ORF using standard laboratory methods. Four putative Atsp] clones were purified to single cell clones. Deletion of tsp] was verified by Southern analyses from these clones (Fig. 18A) using standard laboratory methods described in Example 1 for M181 and M195. Southern analyses also indicated that only four transformants (two parallel clones from two transformants, clones 16 5AA, 16-5BA, 16-11AA, 16-11BA, Figs. 18B and 18C) were single integrants. The other clones were determined to carry additional copies somewhere else in the genome and were discarded. To exclude that the faint signal seen in Figure 18 for the tsp] ORF in transformants would originate from tsp] gene, the deletion of tsp] ORF was confirmed by PCR using the primers in Table 3.2. No signal for tsp] ORF was obtained. The clone (16-5AA) used in removal of the pyr4 blaster cassette (and to generate the triple deletion strain M277) was designated with strain number M219 (Apep1Atspl). Generation of MAB01 producing Apep1Atsp] double deletion strains M252 [00350] To remove vector sequence, plasmid pTTv42 (Atsp]-bar) was digested with PmeI and the correct fragment purified from agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the tsp] deletion cassette was used to transform strain M181 (Apep], Example 1). Preparation of protoplasts and transformation were carried out using bar selection essentially as described for the pep] deletion strain M182 in Example 1. [00351] Colonies growing on transformation plates were picked as selective streaks. Clones growing fast as selective streaks were screened by PCR using the primers listed in Table 3.2 for the correct integration using standard laboratory methods. Putative disruptants were purified to single cell clones. Deletion of tsp] was verified by Southern analyses from these clones (Fig. 19A) using standard laboratory methods described in Example 1 for M181 and M195. All clones were also verified to be single integrants (Figs. 19B andl9C). One double protease deletion clone (13-172D) was designated with number M194. 111 WO 2013/102674 PCT/EP2013/050126 Table 3.2: Primers for screening removal of pyr4 blaster cassette and for screening tsp1 integration and strain purity. For screening removal of pyr4 blaster cassette from M195 T083_74156_5aseq GATCGACAAAGGTTCCAGCG (SEQ ID NO: 297) T084_74156_3aseq AATTGTATCATTCCGAGGCT (SEQ ID NO: 298) For screening integration of pTTv42 Primer Sequence T307_71322_5int CTGTTTGGCCCTCGAAACT (SEQ ID NO: 299) T032_Barloppujor CATTGTTGACCTCCACTAGC (SEQ ID NO: 300) T308_71322_3int TTCGCCATCCAAATTTCTTC (SEQ ID NO: 301) T031_Baralkurev2 GTTTCTGGCAGCTGGACT (SEQ ID NO: 302) For screening integration of pTTv72 Primer Sequence T307_71322_5int CTGTTTGGCCCTCGAAACT (SEQ ID NO: 303) T027_Pyr4_orf startrev TGCGTCGCCGTCTCGCTCCT (SEQ ID NO: 304) T308_71322_3int TTCGCCATCCAAATTTCTTC (SEQ ID NO: 305) T028_Pyr4_flankrev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 306) For screening deletion of tsp1ORF T309_71322_5orfpcr CCCAAGTCGTCTCAGCTCTC (SEQ ID NO: 307) T310_71322_3orfpcr TCGAAGGCTTCAGTGAGGTAA (SEQ ID NO: 308) [00352] The double protease deletion strain M194 was used to generate the MABO antibody expressing strains M247 and M252 below. Construction of strain M247 was carried out by transforming M194 with MABO heavy and light chain constructs (pTTvl01 + pTTvl02). Strain M252 was constructed by transforming M194 with MABO heavy and light chain constructs (pTTv99 + pTTv67). Both transformations were based on hygromycin and acetamide selection. Analysis of MABO producing ApeplAtspl double deletion strain M252 [00353] The MABO antibody producing double deletion strain (ApeplAtspl) was shown to produce 261 mg/l antibody, with 43% full length antibody, when grown in a fermentor. The protease activity of the strain was then tested by growing the strain in Trichoderma minimal medium supplemented with 20 g/l spent grain extract, 60 g/l lactose, and 9 g/l casamino acids at pH 5.5 and 22'C. The total protease activity against casein in this strain was determined to be 2.0-fold less than the wild type M124 strain (Fig. 20). 112 WO 2013/102674 PCT/EP2013/050126 Identification of the 65 kD Serine Protease SLP1 [00354] The protease producing the activity around 65 kD was more difficult to identify due to its low expression level and proximity in size to several highly expressed proteins. The highly expressed proteins were previously identified to be CBHI, CBHII, CIP2, and xylanase 4. Improvements were made to better separate the 65 kD protease from the highly expressed proteins. The improvements included using a lower gel percentage (7%) SDS PAGE gel for zymogram and standard SDS PAGE gels to run the samples a longer time so that the 54 kD molecular weight marker was at the bottom of the gels. Additionally, fermentation supernatant from a T. reesei rituximab antibody transformant was also used to purify the serine proteases. The rituximab antibody transformant is strain M169, which produces rituximab and lacks protease deletions. The strain was grown in Trichoderma minimal medium supplemented with 20 g/l spent grain extract and 60 g/l lactose at pH 5.5 and 28'C. The CBHI produced in this culture lacks the cellulose binding domain; therefore it is around 10 kD smaller. However, M169 did not show a distinct band corresponding to the 65 kD protease (Fig. 21). Thus, the general region was cut and subjected to in-gel trypsin digestion with sequencing grade modified trypsin (Promega #V5 111). The resulting peptides were extracted from the gel and purified by C 18 ZipTip (Millipore #ZTC1 8M096). The purified peptides were analyzed by LC-MS/MS on a QSTAR Pulsar, ESI-hybrid quadrupole-TOF (AB Sciex). [00355] The peptide analysis showed that the second highest scoring protein was the protease tre51365. The top scoring protein was xylanase4, which was a contaminant in the sample. The tre51365 subtilisin protease, now called SLP1, was found in 3 independent samples from three separate purifications. In the best scoring sample, 6 peptides were found and sequenced by LC MS/MS. The sequence coverage was 8%, since the native protease gene codes for 882 amino acids that compose a 93 kD protease. In gelatin zymography, a weak band at -90 kD could be seen along with smearing down to 65 kD suggesting that the SLP1 protease itself undergoes proteolysis but retains much of its activity. Generation of sip] deletion plasmid 113 WO 2013/102674 PCT/EP2013/050126 [00356] The gene encoding SLP1 (sip]) was then deleted in the MABO antibody production strain M244 (Apepl). [00357] The deletion plasmid for the subtilisin-like protease sip] (TreID51365) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. 1094 bp of 5' flanking regions and 1247 bp of 3' flanking region were selected as the basis of the sip] deletion plasmid. Fragments were produced by PCR using the primers listed in Table 3.3. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. Template used in the PCR of the flanking regions was from the T. reesei wild type strain QM6a. The pyr4 blaster cassette was obtained from pTTv71 (Example 1) with NotI digestion. The vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for sip] (pTTvl26) results in 2951 bp deletion in the sip] locus and covers the complete coding sequence of SLP1. Table 3.3: Primers for generating sip1 deletion plasmid. Deletion plasmid pTTv126 for sip1 (TreID51365), vector backbone pRS426 Primer Sequence 5flankfwvect GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACATCTCGGAGT GATGCTTCCT (SEQ ID NO: 309) slp1_5flankrev-pyr4Pro GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCGGCC m GCATCAGACGAAACCAGACGAG (SEQ ID NO: 310) slp1_3flankfw-pyr4Term CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGGCCG CGCGAATCGAGTTGATGATTC (SEQ ID NO: 311) 3flankrevvect GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACCTGGTTGGGA TCTGACCACT (SEQ ID NO: 312) Generation of MABO] producing Apep1Aslp] deletion strain M298 and M299 [00358] To generate the MABO antibody producing strain for the second protease deletions, the pep] deletion strain M181 (in Example 1) was transformed with MAB01 light and heavy chain constructs (pTTv98+pTTv67) using hygromycin and acetamide in selection. The removal of the pyr4 blaster cassette frompep] locus was carried out essentially as described for M195 114 WO 2013/102674 PCT/EP2013/050126 above (in generation of double protease deletion strain M219). This pyr4- strain was designated with number M285 and used as the parent for the subsequent protease deletion. [00359] To remove vector sequence, plasmid pTTv126 (Aslpl-pyr4) was digested with PmeI and the correct fragment purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the sip] deletion cassette was used to transform M285 (pyr4- of MAB01 antibody strain M244, based on Apep1 strain M181). Preparation of protoplasts and transformation were carried out using pyr4 selection essentially as described for the pep] deletion strains M181 and M195 in Example 1. [00360] Colonies growing on transformation plates were picked as selective streaks. Clones growing fast as selective streaks were screened by PCR using the primers listed in Table 3.4 for the correct integration using standard laboratory methods. Putative disruptants were purified to single cell clones. Table 3.4: Primers for screening sip1 integration and strain purity. For screening integration of pTTv126 Primer Sequence T079_slplscrn_5forw GCAGACAAACAGAGCAACGA (SEQ ID NO: 313) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 314) T080_slplscrn_3rev TAGAGGGTGTCGATGGAAGC (SEQ ID NO: 315) T028_Pyr4_flankrev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 316) For screening deletion of slp1ORF T081_slplorf fw GGTCTCTTCTTTGCCAGCAC (SEQ ID NO: 317) T082_slplorf rev TGTCGCTGAACTGAATTTGC (SEQ ID NO: 318) Analysis of MABO producing ApepIAsipI double deletion strain M298/M299 [00361] Deletion of slp1 in the M244 strain showed an expected improvement in heavy and light chain production (Figs. 12 and 13). The slp1 deletion strain (Apep1Aslp1) was grown in a 2 litre shake flask culture containing 300 ml of Trichoderma minimal medium supplemented with 40 g/l lactose, 20 g/l spent grain extract, and 9 g/l casamino acids and buffered to pH 5.5 with 100 mM PIPPS. As described in Example 2 above, the culture supernatants were run on a 4-15% 115 WO 2013/102674 PCT/EP2013/050126 PAGE gel and immunoblotted to detect the MABO heavy and light chain. The heavy chain was produced at levels that were 2.8-fold higher than the production levels of the M244 parent strain (Fig.13). The light chain was produced at levels that were 1.8-fold higher than the production levels of the M244 parent strain (Fig. 13). Identification of Additional Serine Proteases [00362] Additional antibody degrading serine proteases were identified using other affinity ligands. The soybean trypsin inhibitor (SBTI) effectively stabilizes the antibody heavy and light chain. Therefore, it is able to inhibit proteases that are responsible for cleaving the antibody. Thus, in order to identify these proteases, affinity purification was performed with SBTI coupled to agarose (Sigma #T0637). [00363] The T. reesei strain M44 was used to identify the proteases. The M44 strain is a wild type strain with no heterologous protein expression. The M44 strain was grown in Trichoderma minimal medium supplemented with 20 g/l spent grain extract and 60 g/l lactose at pH 5.5 and 28'C. A 20 ml sample of M44 culture supernatant from a 217 hour sample was incubated with the SBTI-agarose affinity resin (1 ml) in 30 ml of binding buffer (50 mM Tris, 0.5 M NaCl, pH 7.5) (pH 5,5; 28'C; 20 g/L spent grain extract, 60 g/L lactose). The supernatant binding buffer mixture was combined in a 50 ml conical tube and agitated at room temperature for 1 hour. The mixture was then added to a glass column and washed with 200 ml of binding buffer. 50 ml of high salt buffer (1 M NaCl) was next used to further remove nonspecific interactions. Finally, the column was washed again with 100 ml of the original binding/wash buffer. The column was then eluted with 0.8 M benzamidine HCl in 50 mM Tris, pH 5.0. The fractions were collected in 0.5 ml volumes and subjected to a protein assay using BioRad Bradford reagent with bovine immunoglobulin as a standard. [00364] From all the fractions collected, 190 pg of protein was purified from the SBTI affinity column. The peak fraction was washed in a vivaspin ultrafiltration spin filter (Sartorius-stedim) with 10 kD molecular weight cutoff to remove the benzamidine inhibitor and concentrate the fraction. The concentrated fractions (cf3 and cf4) and nonconcentrated fractions (f 1-f4) were 116 WO 2013/102674 PCT/EP2013/050126 loaded on an MAB02 zymogram gel (as described above) and on a regular SDS PAGE gel for analysis. The results of the zymogram show that there are two visible proteolytic activities (Fig. 22). The most predominant band was visible around 40 kD and a fainter band was visible around 26 kD (Fig. 22). In the zymogram gel, darker staining protein bands flanked the white zymogram activity band. Comparing this to concentrated fractions loaded on an SDS PAGE gel, these doublet bands could be seen around 38 kD (Fig. 23). The PAGE gel was a 4-15% gradient gel and the zymogram gel was 12%, so the relative sizes can be slightly different. On the PAGE gel, a protein band could clearly be seen in the area of 26 kD, which corresponded to the size of the second fainter zymogram activity. [00365] To further analyze the proteolytic activity of the purified protease of cf3, the fraction was tested for its ability to degrade the rituximab antibody heavy chain. A 5 l sample of cf3 was incubated in sodium citrate buffer pH 5.5 with 0.05 pg/ml rituximab. The incubated samples were then analyzed by immunoblotting using an anti-human IgG heavy chain-specific AP conjugated antibody (Sigma #A3188) diluted 1:30,000 in TBST. The results of the immunoblot show that the proteases immediately degraded the rituximab antibody heavy chain. The full length rituximab heavy chain runs at just over 50 kD, while the initial degradation product was around 45 kD (Fig. 24). Additionally, incubation overnight generated an additional product of 38 kD (Fig. 24). [00366] The proteases responsible for the zymogram activities were identified after LC MS/MS peptide sequencing. Protein containing gel sections were cut out of the SDS PAGE gel shown in Figure 23 and subjected to in-gel trypsin digestion with sequencing grade modified trypsin (Promega #V5 111). The resulting peptides were extracted from the gel and purified by C18 ZipTip (Millipore #ZTC18M096). The purified peptides were analyzed by LC-MS/MS on a QSTAR Pulsar, ESI-hybrid quadrupole-TOF (AB Sciex). [00367] The top scoring protease hit was the subtilisin like protease, slp2 (tre123244). Two peptides from slp2 were found and sequenced, covering 6% of the entire sequence length. The full length slp2 protease is 58 kD, but it is usual that the active protease can be smaller in size. 117 WO 2013/102674 PCT/EP2013/050126 [00368] There were also other proteases found in adjacent regions. Analysis of the lower 26 kD region identified the trypsin serine-like protease tsp] (tre73897). This corresponded to the faint zymogram activity observed. As described above, this protease was identified via aminobenzamidine affinity purification. [00369] In addition, the whole SBTI affinity purified fraction was trypsin digested in solution to determine the entire protease content of the sample. Other identified proteases included the tre123865 protease sip7 (60 kD); the tre77579 protease pep4 (42 kD); and the tre58698 protease sip8 (41 kD). [00370] The Trichoderma reesei subtilisin proteases sip5, sip6, and sip7 were overproduced in Pichia supernatants for investigation of their activity against the antibody rituximab and MABO heavy chains (Fig. 25). The rituximan mock supernatant was compared to supernatants containing sip5 and sip6 (Fig. 25A). The MABO mock supernatant was compared to supernatants containing sip7 (Fig. 25B). Rituximab and MABO were added to the protease containing Pichia supernatants and incubated overnight at 37 0 C. Samples were taken and analyzed by immunoblotting with an anti-heavy chain AP conjugated antibody. This analysis revealed that the slp6 protease showed heavy degradation activity on the rituximab heavy chain and light degradation of the MABO1, compared to the mock control supernatants (Fig. 25). Generation of sip2 and sip3 deletion plasm ids [00371] Based on the above results, the sip2 and sip3 protease genes were each deleted from the MABO1 antibody producing strain M244. [00372] The deletion plasmids for the subtilisin-like proteases sip2 (TreID123244) and sip3 (TreID123234) were constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. 1000 bp of 5' and 1100 bp of 3' flanking regions were selected as the basis of the sip2 deletion plasmid. For sip3, 1000 bp of 5' and 1100 bp of 3' flanking regions were selected. Fragments were produced by PCR using the primers listed in Table 3.5. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. Template used in the PCR of 118 WO 2013/102674 PCT/EP2013/050126 the flanking regions was from the T. reesei wild type strain QM6a. The pyr4 blaster cassette was obtained from pTTv71 (Example 1) with NotI digestion. The vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmids were constructed using the yeast homologous recombination method described in Example 1. The deletion plasmid for sip2 (pTTv1 15) results in a 2114 bp deletion in the sip2 locus and covers the complete coding sequence of SLP2. The deletion plasmid for sip3 (pTTv1 16) results in a 1597 bp deletion in the sip3 locus and covers the complete coding sequence of SLP3. Table 3.5: Primers used for plasmids. Deletion plasmid pTTv115 for slp2 (TreID123244), vector backbone pRS426 Primer Sequence JJ-037 primer GATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAA CGCAGTCTATCCCATCCCTG (SEQ ID NO: 319) JJ-038 primer GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCGGCC GCGCGGATGATGAAGGAAGAAG (SEQ ID NO: 320) JJ-039 primer CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGGCCG CAACAGCTGTTCGCACGCGTG (SEQ ID NO: 321) JJ-040 primer TGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCGTTTAAA CGGCTGGGCATTGGGGCCG (SEQ ID NO: 322) Deletion plasmid pTTv116 for slp3 (TreID123234), vector backbone pRS426 Primer Sequence JJ-041 primer GATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAA CAAACAAGGCACAAAGGCCTG (SEQ ID NO: 323) JJ-042 primer GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCGGCC GCATCCAAGGATGAGGAGAAC (SEQ ID NO: 324) JJ-043 primer CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGGCCG CACCTAATGGTTTCTTCGTTTTTC (SEQ ID NO: 325) JJ-044 primer TGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCGTTTAAA CCGGTCCGAAGGGTGTTTTGG (SEQ ID NO: 326) Generation of MABO producing Apep1Asip2 and Apep1Asip3 deletion strains M292 and M295 [00373] To generate the MABO antibody producing strain for the second protease deletions, the pep] deletion strain M181 (in Example 1) was transformed with MAB01 light and heavy chain constructs (pTTv98+pTTv67) using hygromycin and acetamide in selection. The removal of the pyr4 blaster cassette frompep] locus was carried out essentially as described for M195 119 WO 2013/102674 PCT/EP2013/050126 above (in generation of double protease deletion strain M219). This pyr4- strain was designated with number M285 and used as the parent for the subsequent protease deletions. [00374] To remove vector sequence, plasmids pTTvl 15 (Aslp2-pyr4) and pTTvl 16 (Aslp3 pyr4) were digested with PmeI and the correct fragments purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of either deletion cassette was used to transform M285 (pyr4- of MABO1 antibody strain M244, based on Apep1 strain M1 81) separately. Preparation of protoplasts and transformation were carried out using pyr4 selection essentially as described for the pep] deletion strains M181 and M195 in Example 1. [00375] Colonies growing on transformation plates were picked as selective streaks. Clones growing fast as selective streaks were screened by PCR using the primers listed in Table 3.6 for the correct integration using standard laboratory methods. Putative disruptants were purified to single cell clones. No pure clones were obtained even after repeated purification steps. Table 3.6: Primers for screening slp2 (pTTvl15) and slp3 (pTTvl16) integration and strain purity. For screening integration of pTTv115 Primer Sequence T054_slp2_5screenF GATGCACCGCTGCGGCC (SEQ ID NO: 327) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 328) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 329) T055_slp2_3screenR GGCGTTGCTCCCCATGCG (SEQ ID NO: 330) For screening deletion of slp2 ORF T111_slp2_ORFF ATGCGGTCCGTTGTCGCC (SEQ ID NO: 331) T I12_slp2_ORFR TTACTCGGAGAGCTCAGAGA (SEQ ID NO: 332) For screening integration of pTTv116 Primer Sequence T056_slp3_5screenF GTGAATGGGTGGCAACATGA (SEQ ID NO: 333) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 334) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 335) T057_slp3_3screenR CATCAAGTTGACCACCATTGT (SEQ ID NO: 336) For screening deletion of slp3 ORF T113_slp3_ORFF ATGCGGTTGTCCGTCCTCC (SEQ ID NO: 337) TI 14_slp3_ORFR TTAACCGGAAGGGTTGCCGT (SEQ ID NO: 338) 120 WO 2013/102674 PCT/EP2013/050126 Analysis of MAB01 producing ApeplAslp2 and ApeplAslp3 double deletion strains M292 and M295 [00376] The M292 strain (Apep1Aslp2) and M295 strain (Apep1Aslp3) were grown along with their sister transformants in a 2 liter shake flask culture containing 300 ml of Trichoderma minimal medium supplemented with 40 g/l lactose, 20 g/l spent grain extract, and 9 g/l casamino acids and buffered to pH 5.5 with 100 mM PIPPS. The culture supernatants were run on a 4-15% SDS PAGE gel and immunoblot analysis was performed to detect the MABO heavy chain and light chain. The results show that both deletions improved MABO stability (Figs. 12 and 13). The Aslp2 deletion improved MABO1 heavy chain expression in shake flask culture by about 2.4 fold on day 7, as compared to the parent M244 strain (Fig. 13). The Aslp3 improved MABO heavy chain expression in large shake flasks by about 1.5-fold and MABO light chain expression by about 1.7-fold as compared to the M244 parent strain (Fig. 13). Moreover, when compared to Aslp3 and Agap], Aslp2 showed the highest fold increased in MABO1 heavy chain expression relative to MABO heavy chain expression in the M244 parent strain (Fig. 13). [00377] When slp2 was deleted from the M306 multiple deletion strain (Apep1Atsp1Aslp1), deletion of slp2 resulted in a reduction in sporulation and slower growth as compared to the parent strain. Example 4 - TRICHODERMA MULTIPLE PROTEASE DELETION STRAINS [00378] This example demonstrates increased antibody production and stability from Trichoderma reesei (T. reesei) strains containing multiple deletions of the protease genes identified above in Examples 1-3. Generation of Triple Deletion Strain Apep1Atsp1Aslpl [00379] A T. reesei strain having a triple deletion Apep1Atsp1Aslp1 was generated and tested for improvement in antibody production. The strain was also used for further rounds of protease deletions. 121 WO 2013/102674 PCT/EP2013/050126 Generation of triple protease deletion strain M277 [00380] To generate a marker-free triple protease deletion strain, the looping out of the pyr4 marker was applied to strain M219 essentially as described above for looping out pyr4 from the single protease deletion strain Apep1. Three consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. Final clones were verified for the looping out of pyr4 by PCR (using the primers listed in Table 3.1); no specific signals were seen with primers annealing with the looped out part of the pyr4. The looping out was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. The clone used to generate the triple protease deletion strain was designated with strain number M228 (ApeplAtspl, pyr4-). [00381] The deletion plasmid pTTv 126 for the third protease gene, subtilisin-like protease slp1 (TreID51365) is described above (Table 3.3). This deletion plasmid results in 2951 bp deletion in the slp1 locus and covers the complete coding sequence of SLP1. [00382] To remove vector sequence, plasmid pTTv126 (Aslp1-pyr4 loopout) was digested with PmeI and the correct fragment purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the slp1 deletion cassette was used to transform M228 (ApeplAtspl, pyr4 ) above. Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00383] 200 clones were picked as first streaks. 48 of these streaks were screened by PCR using the primers listed in Table 4.1 for the correct integration using standard laboratory methods. Five putative triple protease disruptants (Apep1Atsp1Aslp1) were purified to single cell clones. Deletion of slp1 was verified by Southern analyses of the five clones (Fig. 26A). Southern analyses were performed as described in Example 1. Southern analyses also verified that three of the clones were single integrants (Figs. 26B and 26C). The two other clones were shown to carry additional copies somewhere else in the genome and were discarded. The clone used in removal of the pyr4 blaster cassette (and to generate the quadruple protease deletion strain M307 below) was designated with strain number M277 (Apep1Atsp1Aslp1). 122 WO 2013/102674 PCT/EP2013/050126 Table 4.1: Primers for screening removal of pyr4 blaster cassette and for screening sipi integration and strain purity. For screening removal of pyr4 blaster cassette from M219 Primer Sequence T307_71322_5int CTGTTTGGCCCTCGAAACT (SEQ ID NO: 339) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 340) T308_71322_3int TTCGCCATCCAAATTTCTTC (SEQ ID NO: 341) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 342) For screening integration of pTTv126 Primer Sequence T079_slp1_scrn _5forw GCAGACAAACAGAGCAACGA (SEQ ID NO: 343) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 344) T080_slplscrn_3rev TAGAGGGTGTCGATGGAAGC (SEQ ID NO: 345) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 346) For screening deletion of slp1ORF T081_slp1_orffw GGTCTCTTCTTTGCCAGCAC (SEQ ID NO: 347) T082_slplorf rev TGTCGCTGAACTGAATTTGC (SEQ ID NO: 348) Generation of MABO producing triple protease deletion strain M304 [00384] To generate the MABO antibody producing strain for the third protease deletion, the pep1Itsp1 double protease deletion strain M194 (Example 3) was transformed with MABO light and heavy chain constructs (pTTv99+pTTv67) using hygromycin and acetamide in selection. This MABO strain with pep1/tspldouble deletion was designated with number M252. Removal of the pyr4 blaster cassette from pep] locus was carried out essentially as described in Example 3 for M195 (in generation of double protease deletion strain M219). This pyr4- strain was designated with number M284 and used as the parent for the subsequent protease deletion. [00385] The third protease deletion to M284 was obtained by using slp1 deletion construct pTTvl28. This construct contains a native KEX2 overexpression cassette targeted to the slp1 locus. Transformation was carried out essentially according to the protocol described in Example 1 for the strains M181 and M195 using pyr4 selection. The resulting strain is the MABO producing triple protease deletion strain M304. 123 WO 2013/102674 PCT/EP2013/050126 Analysis of MAB01 producing Triple Protease Deletion Strain M304 [00386] The triple protease deletion (Apep1Atsp1Aslp1) MABO antibody producing strain M304 was shown to produce the MABO antibody at yields of up to 3.5 g/L in culture (pH 5,5; 28->22'C; 60 g/L spent grain, 30 g/L glucose, 60 g/L lactose + lactose feed), and product quality up to 84% of full length IgG (see Example 6 below). The protease activity of the strain was also tested by growing the strain in Trichoderma minimal medium supplemented with 60 g/l solid spent grain, 30 g/l glucose, and 60 g/l lactose at pH 5.5. The culture was grown up at 30'C and then shifted to 22'C for the production phase. The fedbatch cultivation was done with a lactose feed. The total protease activity against casein in this strain was determined to be about 3.2-fold less compared to the wild type strain M124 (Fig. 20). Comparison of Single, Double, and Triple Deletion Strains [00387] The relative protease activity of culture supernatants from the single protease deletion (Apepl) strain M181 (see Example 1), the double protease deletion (ApeplAtspl) strain M219 (see Example 3), and the triple protease deletion (Apep1Atsp1Asip1) strain M277 were compared. These deletion strains were compared to the wild type strain M124. The three protease deletion strains were grown in 2 liter shake flasks with 300 ml TrMM containing 40g/l lactose, 20 g/l spent grain extract, and 100 mM PIPPS at pH 5.5. Samples were taken on days 3, 5, 7, and 10. Day 7 culture supernatant samples from M124, M181, M219, and M277 were each diluted 1:2 in sodium citrate buffer (50 mM, pH 5.5) and 30 l were loaded on a 12% zymogram SDS PAGE gel containing MAB02. The SDS PAGE gel was run at 100V for 45 minutes. The gel was then incubated in 2.5% Triton X-100 for one hour, before being washed several times with the reaction buffer (50 mM sodium citrate, pH 5.5). The zymogram gel was then left overnight shaking in the reaction buffer. The next morning the gel was stained with GelCode Blue staining reagent. Regions where the MAB02 antibody has been degraded showed up as white spots on the blue stained gel. [00388] Two protease activities were seen in the control M124 and the M181 Apep1 samples (Fig. 27). The most predominate activity was seen between 65-90 kD, which corresponds to sip]. 124 WO 2013/102674 PCT/EP2013/050126 A fainter activity was seen around 28 kD, which corresponds to tsp]. As was expected, the M219 Apep1Atsp1 strain did not produce a zymogram band at 28 kD. Likewise, the M277 Apep1Atsp1Aslp1 strain did not produce either zymogram activity. The active size of sip] appears to be variable, since it was still active when it was cleaved down to 65 kD even though its mature size is 90 kD. The size variation can be seen in Figure 27. [00389] The total protease activity against succinylated casein from supernatant cultures of the M181, M219, and M277 deletion strains was also measured from day 3, day 5, and day 7 samples. The supernatants were first diluted to 2 mg/ml total protein in 50 mM sodium citrate, pH 5.5 before being assayed. 50 l of diluted supernatant was loaded into a 96 well plate and 50 l of succinylated casein was added to begin the reaction. A background control with buffer instead of casein was used for each sample. After the addition of casein the protease reaction was allowed to proceed for 1 hour at 37'C. To develop the reaction 50 PI of TNBSA reagent was added to every well and the plate incubated for 16 hours at 37'C. The absorbance at 450 nm was measured for the whole plate. The nonspecific background signal is subtracted from specific protease activity measurement. As shown in Figure 28, the supernatant samples from the three protease deletion strains contained less protease activity than the M124 wild type strain. [00390] The supernatant from the M277 and M124 cultures (day 5 and 7) was diluted to 6 mg/ml in 50 mM sodium citrate buffer. To these diluted supernatants the MABO antibody was spiked in to a final concentration of 0.05 pg/pl. These reactions were incubated at 37'C overnight. The reactions were sampled at zero time, 1 hour, and over overnight incubation. The 20 l samples were loaded into a 4-15% SDS PAGE gel and run at 200 volts for 40 minutes. The gel was transferred at 100 volts for 1 hour to nitrocellulose for immunoblotting. The membrane was blocked with 5% milk in TBST for one hour. The heavy chain of MABO was detected with an anti-heavy chain AP conjugated antibody (Sigma #A3188) diluted 1:30,000 in TBST. After washing the membrane with TBST, the blot was developed with AP substrate (Promega). Comparing the overnight incubated samples it was clearly evident that the heavy chain degraded more in the M124 strain supernatant. The M124 contains no protease deletions. With 3 protease deletions, the M277 strain produced MABO1 heavy chain that was significantly stabile. On day 5, 125 WO 2013/102674 PCT/EP2013/050126 there was 2.5-fold more heavy chain in the M277 supernatant after overnight incubation. With the day 7 supernatant, there was 4-fold more heavy chain visible (Fig. 41). Quadruple Deletion Strain M307 [00391] The M307 strain having a quadruple deletion Apep1Atsp1Aslp1Agap1 was generated and used for further rounds of protease deletions. Generation of quadruple protease deletion strain M307 [00392] To generate a marker-free quadruple protease deletion strain, removal of the pyr4 blaster cassette was applied to strain M277 essentially as described in Example 3 for removal of the pyr4 blaster cassette from the single protease deletion strain M195 (Apep1). Three consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. Final clones were verified for the removal of the blaster cassette by PCR using the primers listed in Table 4.2 with standard laboratory methods. No specific signals were seen with primers annealing with the removed part of the pyr4. Removal was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. No growth was observed on the plates without uridine supplementation. The clone used to generate the quadruple protease deletion strain was designated with strain number M306 (ApeplAtsplAslpl, pyr4-). [00393] The deletion plasmid pTTv1 17 for the fourth protease gene, glutamic protease gap] (TreID69555) is described in Example 2 (Table 2.1). This deletion plasmid results in a 1037 bp deletion in the gap] locus and covers the complete coding sequence of GAP1. [00394] To remove vector sequence, plasmid pTTv 117 (Agap1-pyr4) was digested with PmeI and the correct fragment purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the gap] deletion cassette was used to transform M306 (Apep1Atsp1Aslp1, pyr4-) above. Preparation of protoplasts and transformation were carried out essentially as described in Example Ifor the strains M181 and M195 using pyr4 selection. 126 WO 2013/102674 PCT/EP2013/050126 [00395] 150 clones were picked as first streaks. 48 of these streaks were screened by PCR using the primers listed in Table 4.2 for the correct integration using standard laboratory methods. Eight putative quadruple protease disruptants (Apep1Atsp1Aslp1Agap1) were purified to single cell clones. Deletion of gap] was verified by Southern analyses of the eight clones (Fig. 29A). Southern analyses were performed as described in Example 1. Southern analyses also verified that three of the clones were single integrants (Figs. 29B and 29C). The five other clones were shown to carry additional copies somewhere else in the genome and were discarded. The clone used in removal of the pyr4 blaster cassette (and to generate the quintuple protease deletion strain M369 below) was designated with strain number M307 (Apep1Atsp1Aslp1Agap1). Table 4.2: Primers for screening removal of pyr4 blaster cassette and for screening gap1 integration and strain purity. For screening removal of pyr4 blaster cassette from M277 Primer Sequence T079_slplscrn_5forw GCAGACAAACAGAGCAACGA (SEQ ID NO: 349) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 350) T080_slplscrn_3rev TAGAGGGTGTCGATGGAAGC (SEQ ID NO: 351) T028_Pyr4_flankrev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 352) For screening integration of pTTv117 Primer Sequence T052_gapl5screenF CTCAGAAAGGTTGTAGTTGTGA (SEQ ID NO: 353) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 354) T053_gap1_3screenR GATGTTGTGTTTTCAGTCTGCA (SEQ ID NO: 355) T028_Pyr4_flankrev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 356) For screening deletion of gap1 ORF T109_gaplORFF ATGTTCATCGCTGGCGTCG (SEQ ID NO: 357) Ti10_gaplORFR CTAAACGTAAGAGCAGGTCAA (SEQ ID NO: 358) Generation of MABO producing quadruple protease deletion strain M371 [00396] To generate quadruple protease deletion strain with MABO antibody production, removal of the pyr4 blaster cassette from slp1 locus from strain M304 was carried out essentially as described in Example 3 for M195 (in generation of double protease deletion strain M219). 127 WO 2013/102674 PCT/EP2013/050126 This pyr4- strain was designated with number M317 and used as the parent for the subsequent protease deletion. [00397] The fourth protease deletion to M317 was obtained by using gap] deletion construct pTTv1 17 above. Transformation was carried out essentially according to the protocol described in Example 1 for the strains M181 and M195 using pyr4 selection. The resulting strain is the MAB01 producing quadruple protease deletion strain M371. Analysis of quadruple protease deletion strain [00398] The total protease activity of culture supernatant from the quadruple deletion strain M307 was then measured and compared with culture supernatants from the triple deletion strain M277 and the wild type strain M124. Each strain was grown in 2 liter shake flasks with 300 ml TrMM containing 40 g/l lactose, 20 g/l spent grain extract, and 100 mM PIPPS at pH 5.5. Day 7 supernatant samples were taken for total protease assay. The total protein concentrations of the supernatants were measured using the BCA assay with bovine immunoglobulin as the standard. The supernatants were diluted serially 1:2 in sodium citrate buffer at pH 5.5. The diluted supernatants were added to fluorescently labeled casein substrate and incubated at 37 0 C. The fluorescence was measured after 1 hour at 485 nm excitation and 530 nm emission. The results showed that rate of protease activity of the triple deletion strain M277 was 3 times less than the wild type strain M124 and the quadruple deletion strain M307 was 8 times less than the wild type strain M124 (Fig. 30). [00399] Additionally, Figure 20 summarises the total protease activity against casein from the M188 single deletion strain, the M219 double deletion strain, the M277 triple deletion strain, and the M307 quadruple deletion strain as compared to the wild type M124 strain. The pep] single deletion reduced the protease activity by 1.7-fold, the pep1/tsp1 double deletion reduced the protease activity by 2-fold, the pep1/tsp1/slp1 triple deletion reduced the protease activity by 3.2 fold, and the pep1/tsp1/slp1/gap1 quadruple deletion reduced the protease activity by 7.8-fold compared to the wild type M124 strain (Fig. 20). 128 WO 2013/102674 PCT/EP2013/050126 [00400] The MABO antibody producing strain M371 contains a quadruple deletion Apep1Atsp1AsIp1Agap1. The strain was grown in the fermentor and compared to the triple deletion MABO producing strain under the same conditions. The batch cultivation was performed with the M371 strain that produced MABO1 and was with pep], tsp], sip1, and gap] protease deletions and kex2 overexpression. The strain was grown in Trichoderma minimal medium supplemented with 40 g/l solid spent grain, 40 g/l glucose, and 40 g/l lactose at pH 5.5. The culture was grown up at 30'C and then shifted to 22'C for the production phase. The batch cultivation was performed with the M304 strain that produced MABO1 and was with pep], tsp], and sip] protease deletions and kex2 overexpression. The strain was grown in Trichoderma minimal medium supplemented with 40 g/l solid spent grain, 40 g/l glucose, and 40 g/l lactose at pH 5.5. The culture was grown up at 30'C and then shifted to 22'C for the production phase. [00401] The full length antibody yield calculated was 20% higher in the gap] deletion strain from the day 6 sample. Under the same conditions, the quadruple deletion strain produced 1.9 g/L (897 mg/L full length antibody) and the triple deletions strain produced 1.3 g/L (731 mg/L full length antibody). From the fermentor supernatants, the total protease activity against casein was measured. The supernatant samples were diluted in sodium citrate buffer pH 5.5 so that the total protein concentration was 0.15 mg/ml for all samples. To this diluted supernatant 10 P g/ml BODIPY casein was added to begin the protease assay. Samples from each day of the cultivation were compared between the two different strains. The results show that there was up to 30% less total protease activity in the gap] deletion strain on day 5 (Fig. 31). On day 6, the protease activity was 20% lower, which correlates to the 20% improvement in antibody yield on that day. Quintuple Deletion Strain [00402] The M369 strain having a quintuple deletion Apep1Atsp1As/p1Agap1 Agap2 was generated and used for further rounds of protease deletions. Generation of quintuple protease deletion strain M369 [00403] To generate a marker-free quintuple protease deletion strain, removal of the pyr4 blaster cassette was applied to strain M307 essentially as described in Example 3 for removal of 129 WO 2013/102674 PCT/EP2013/050126 the pyr4 blaster cassette from the single protease deletion strain M195 (Apepl). Three consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. Final clones were verified for the removal of the blaster cassette by PCR using the primers listed in Table 4.3 with standard laboratory methods. No specific signals were seen with primers annealing with the removed part of the pyr4 blaster cassette. Removal was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. No growth was observed on the plates without uridine supplementation. The clone used to generate the quintuple protease deletion strain was designated with strain number M321 (Apep1Atsp1Aslp1Agap1, pyr4-). [00404] The deletion plasmid pTTv145 for the fifth protease gene, glutamic protease gap2 (TreID106661) is described in Example 2 (Table 2.3).This deletion plasmid results in a 944 bp deletion in the gap2 locus and covers the complete coding sequence of GAP2. [00405] To remove vector sequence, plasmid pTTv145 (Agap2-pyr4 loopout) was digested with PmeI and the correct fragment purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the gap2 deletion cassette was used to transform M321 (Apep1Atsp1Aslp1Agap], pyr4 ) above. Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00406] 100 clones were picked as first streaks. All 20 growing streaks were screened by PCR using the primers listed in Table 4.3 for the correct integration using standard laboratory methods. 10 putative quintuple protease disruptants (Apep1Atsp1Aslp1Agap1Agap2) were purified to single cell clones and rescreened by PCR. Only one purified clone was negative for the gap2 ORF. The gap2 deletion was verified by Southern analyses of the clone (Fig. 32A). Southern analyses were performed as described in Example 1. Southern analyses also indicated the clone carries an additional copy of the deletion cassette somewhere else in the genome or has some internal rearrangements in that locus (Figs. 32B and 32C). Since this was the only quintuple protease deletion clone obtained it was selected for further use (Figs. 32D and 32E). Clone 14 was the clone used for removal of the pyr4 blaster cassette, and to generate the 6-fold protease 130 WO 2013/102674 PCT/EP2013/050126 deletion strains M396 and M400 below (Fig. 32E). This clone was designated with strain number M369 (Apepi AtsplAslpl AgaplAgap2). Table 4.3: Primers for screening removal of pyr4 blaster cassette and for screening gap2 integration and strain purity. For screening removal of pyr4 blaster cassette from M307 Primer Sequence T052_gapl5screenF CTCAGAAAGGTTGTAGTTGTGA (SEQ ID NO: 359) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 360) T053_gapl3screenR GATGTTGTGTTTTCAGTCTGCA (SEQ ID NO: 361) T028_Pyr4_flankrev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 362) For screening integration of pTTv145 Primer Sequence T048_gap2_5screenF GCTTGGCATCACGGAAGCT (SEQ ID NO: 363) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 364) T049_gap2_3screen R TTGACAAGAAAGGTCCGGTTG (SEQ ID NO: 365) T028_Pyr4_flankrev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 366) For screening deletion of gap2 ORF T107_gap2_ORFF ATGGATGCTATCCGAGCCAG (SEQ ID NO: 367) T108_gap2_ORFR CTATTCATACTCAACAGTCACA (SEQ ID NO: 368) Analysis of quintuple protease deletion strain [00407] Protease activity from the M369 strain was measured against its parent strain M307. The gap2 protease deletion resulted in 23% less protease activity against casein (Fig. 33). 6-Fold Deletion Strain [00408] The 6-fold protease deletion strain having deletions Apep1Atsp1Aslp1Agap1Agap2Apep4 was generated and used for further rounds of protease deletions. Generation of pep4 deletion plasmids [00409] The deletion plasmid pTTv181 for the sixth protease gene, aspartic protease pep4 (TreID77579) was constructed essentially as described for the Apep1 plasmid pTTv71 in 131 WO 2013/102674 PCT/EP2013/050126 Example 1. 959 bp of 5' flanking region and 992 bp of 3' flanking region were selected as the basis of the pep4 deletion plasmid. As for pep], the first deletion plasmid for pep4 (pTTv43, Table 4.4) carried another selection marker, bar, which was replaced with the pyr4 blaster cassette. The blaster cassette was obtained from pTTv71 with Nod digestion, ligated to Nod cut pTTv43, and then transformed into E. coli using standard methods. A few transformants were cultivated, plasmid DNA isolated and digested to screen for correct ligation and orientation of the pyr4 blaster cassette using standard laboratory methods. One clone with correct insert size and orientation was sequenced and stored (pTTv73, Table 4.4). The blaster cassette was changed slightly once more: the direct repeat fragment used in removal of pyr4 was changed from 308 bp of pyr4 5'UTR to 300 bp direct repeat from the end of pep4 5' flanking region (as in pTTv145, gap2-pyr4). This was made by removing the existing pyr4 blaster cassette from pTTv73 with NotI digestion. The pyr4 gene was amplified by PCR using pTTv73 as a template using the primers in Table 4.4. For the yeast homologous recombination system used in cloning, overlapping sequences for the vector were placed to the appropriate PCR-primers. To enable marker switch in the construct, Nod restriction sites were introduced on both sides of the pyr4 selection marker and for additional cloning steps an AscI site was introduced between the pep4 5'direct repeat and 3' flank. This type of blaster cassette should not leave any additional sequence to the locus of the deleted gene after excision. The 300 bp pep4 5'direct repeat was amplified by PCR using the T. reesei wild type strain QM6a as a template. Products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. A few of the clones obtained from the recombination were cultivated, and plasmid DNA was isolated and digested to screen for correct recombination using standard methods. These deletion plasmids for pep4 (pTTv43, pTTv73 and pTTv181, Table 4.4) result in a 1413 bp deletion in the pep4 locus and cover the complete coding sequence of PEP4. Table 4.4: Primers for generating pep4 deletion plasmids. Deletion plasmid pTTv43 for pep4 (TreID77579), vector backbone pRS426 Primer Sequence T298_77579_5f GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACTCAGGTC AACCACCGAGGAC (SEQ ID NO: 369) 132 WO 2013/102674 PCT/EP2013/050126 T299_77579_5rpt CCCGTCACCGAGATCTGATCCGTCACCGGGATCCACTTAAGCGG CCGCTGAATGGGATGGTTCGATTG (SEQ ID NO: 370) T300_77579_3fpt GCCAAGCCCAAAAAGTGCTCCTTCAATATCATCTTCTGTCGCGG CCGCAGGTAGACGCTTTGCGAGTG (SEQ ID NO: 371) T301_77579_3r GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACTGAACT GACGCGGACTGA (SEQ ID NO: 372) Deletion plasmid pTTv73 for pep4 (TreID77579), vector backbone pTTv43 Primer Sequence no new primers, pTTv43 digested with NotI and ligated with pyr4-loopout fragment from pTTv7l Deletion plasmid pTTv181 for pep4 (TreID77579), vector backbone pTTv73 Primer Sequence T209_pyr4_f_recpep4_5f AAGTTCCCTTCCTCTGGCAGCAATCGAACCATCCCATTCAGCGG CCGCCTAGCATCGACTACTGCTGC (SEQ ID NO: 373) T210_pyr4_r CATGCAAAGATACACATCAA (SEQ ID NO: 374) T21 1_pep4_loop_f_repyr4 TGATTGTACCCCAGCTGCGATTGATGTGTATCTTTGCATGGCGG CCGCTCAATGTTGACTGCCCCAGG (SEQ ID NO: 375) T212_pep4_loop_r_recpep4_3f GCACTTCTTAGATACACACACACTCGCAAAGCGTCTACCTGGCG CGCCTGAATGGGATGGTTCGATTG (SEQ ID NO: 376) Generation of 6-fold protease deletion strains M396 and M400 [00410] To generate a marker-free 6-fold protease deletion strain, removal of the pyr4 marker was applied to strain M369 essentially as described in Example 3 for removal of pyr4 blaster cassette from the strain M195 (Apepl). Three consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. Final clones were verified by PCR using the primers listed in Table 4.5 with standard laboratory methods. Signal corresponding to successful removal of the blaster cassette was obtained for all clones. Removal was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. No growth was observed on the plates without uridine supplementation. Southern analyses of six putative pyr4- clones verified the removal of the blaster cassette for three clones. In addition, the Southern analyses revealed that these three clones have lost the extra signals seen for the gap2 flanks in parent M369. Therefore these clones should have the expected genomic organisation in the gap2 locus. The clone used to generate the 6-fold protease deletion strain was designated with strain number M381 (Apep1Atsp1Aslp1Agap1Agap2, pyr4-). 133 WO 2013/102674 PCT/EP2013/050126 [00411] To remove vector sequence, plasmid pTTv181 (Apep4-pyr4 loopout) was digested with PmeI and the correct fragment purified from an agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the pep4 deletion cassette was used to transform M381 (Apep1Atsp1Aslp1Agap1Agap2, pyr4 ). Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00412] Over 200 transformants were picked as first streaks. 32 growing streaks were screened by PCR (using the primers listed in Table 4.5) for correct integration. Seven clones gave the expected signals and were purified to single cell clones and rescreened by PCR using the primers listed in Table 4.5. Deletion of pep4 was verified by Southern analyses from five clones (Figs. 34A and 34B) using standard laboratory methods described in Example 3 for M181 and M195. Southern analyses also indicated that all transformants (Figs. 34C and 34D) were single integrants. To exclude that the faint signal seen in the PCR screening for the pep4 ORF in transformants would originate from pep4 gene, three clones were purified further via single cell steps and reanalysed by Southern hybridisations and PCR. No signal for pep4 ORF was obtained from either analysis indicating strain purity. Clone 25-120A used for removal of the pyr4 blaster cassette (and in generation of the 7-fold protease deletion strain) was designated with strain number M396 and the repurified clone 25-120A-a with strain number M400. Table 4.5: Primers for screening removal of pyr4 blaster cassette from M369 and for screening pep4 integration and strain purity. For screening removal of pyr4 blaster cassette from M369 Primer Sequence T222_gap2_5ff2 GGCAGGTCGCAGAGCAAGACA (SEQ ID NO: 377) T049_gap2_3screen R TTGACAAGAAAGGTCCGGTTG (SEQ ID NO: 378) For screening integration of pTTv181 Primer Sequence T302_77579_5int GATTCATCACAGGGGCAGTC (SEQ ID NO: 379) T027_Pyr4_orfstartrev TGCGTCGCCGTCTCGCTCCT (SEQ ID NO: 380) T415_77579_3screen ACGCCGTTGCTGAGCCTTG (SEQ ID NO: 381) T061_pyr4orfscreen_2F TTAGGCGACCTCTTTTTCCA (SEQ ID NO: 382) For screening deletion of pep4 ORF 134 WO 2013/102674 PCT/EP2013/050126 T416_77579_probeF GAGCCCATCATCAACACCTC (SEQ ID NO: 383) T417_77579_probeR TGCCAAGGTCGTAGACGGA (SEQ ID NO: 384) Analysis of Protease activity in the 4-, 5-, and 6-Fold Protease Deletion Strains [00413] The quadruple protease deletion strain M307, the quintuple protease deletion strain M369, and the 6-fold protease deletion strain transformants were cultivated in shake flask cultures. Supernatant samples taken from large shake flask cultures grown in TrMM with 20 g/L spent grain and 40 g/L lactose buffered with 100 mM PIPPS at pH 4.8. The pH was -4.25 on day 5. The 6 protease deletion transformants tested were not the final strain, so there was some variation due to the purity of the spores. These were some of the best transformants, but further spore purification was done subsequently. The day 5 supernatants were diluted 1:3 in 50 mM sodium citrate buffer pH 4.5. To this diluted supernatant BODIPY casein FL (10 Pg/ml) was added and incubated together at 37 0 C for 4 hours. To protease activity assay was conducted as described in the manufacture's protocol (enzCheck protease assay kit #E6638, Molecular Probes). The protease activity results can be seen in Figure 33. [00414] There was a small reduction in protease activity when the quintuple protease deletion strain M369 was grown under acidic conditions. The deletion of gap2 in the strain provided a 23% reduction in protease activity against casein. In the 6-fold protease deletion strains the aspartic protease pep4 was deleted in the 5 transformants studied. The best transformant showed a 35% reduction compared to its parent strain M369. Generation of 7-Fold Deletion Strain [00415] The 7-fold protease deletion strain having deletions Apep1Atsp1Aslp1Agap1Agap2Apep4Apep3 was generated and used for further rounds of protease deletions. Generation of pep3 deletion plasmids 135 WO 2013/102674 PCT/EP2013/050126 [00416] The first deletion plasmid pTTv188 for the seventh protease gene, aspartic protease pep3 (TreID121133) was constructed essentially as described for Apep1 plasmid pTTv41 in Example 1. 1215 bp of 5' flanking region and 1082 bp of 3' flanking region were selected as the basis of the pep3 deletion plasmid. As for gap2 (pTTvl45) and pep4 (pTTvl8l) deletion plasmids above, in this plasmid the direct repeat fragment is a 300 bp stretch from the end of pep3 5' flanking region. Fragments were produced by PCR using the primers listed in Table 4.6. As for pTTv181 (Apep4-pyr4) above, to enable marker switch in the construct, NotI restriction sites were introduced on both sides of the pyr4 selection marker and for additional cloning steps an AscI site was introduced between the pep3 5'direct repeat and 3' flank. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. Template used in the PCR of the flanking regions was the T. reesei wild type strain QM6a. The pyr4 marker gene was obtained from pTTv181 with NotI digestion. The vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed using the yeast homologous recombination method described in Example 1. [00417] The second deletion plasmid for the aspartic proteasepep3 (TreID121133), pTTvl92, was constructed using the plasmid pTTv 188 above as the backbone. This second plasmid carries a native KEX2 (TreID123156) overexpression cassette and uses acetamidase (AmdS) gene from Aspergillus nidulans as the selection marker. The pyr4 blaster cassette was removed from pTTv1 88 with NotI-AscI double digestion. The fragments for cDNA1 promoter (template: pTHN3 plasmid DNA), native kex2 (template: T. reesei QM6a genomic DNA), trpC terminator (template: pHHO2 plasmid DNA) and AmdS marker (template: pHHO1 plasmid DNA) were produced by PCR using the primers listed in Table 4.6. As for pTTv 188 above, to enable marker switch in the construct, NotI restriction sites were introduced on both sides of the AmdS selection marker. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. The plasmid was constructed using the yeast homologous recombination method described in Example 1. 136 WO 2013/102674 PCT/EP2013/050126 [00418] The third deletion plasmid for the aspartic proteasepep3 (TreID121133), pTTv205, was constructed using the plasmid pTTv 192 above as the backbone. The AmdS marker was removed from pTTv 192 with Nod digestion. Fragments for a new pyr4 blaster cassette (located after the KEX2 overexpression cassette) were produced by PCR using the primers listed in Table 4.6. In this blaster cassette, the direct repeat is a 300 bp stretch from the beginning of the pep3 3' flanking region and located before the pyr4 gene. As for pTTv192 above, to enable marker switch in the construct, NotI restriction sites were introduced on both sides of the pyr4 blaster cassette. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with gel extraction kit (Qiagen) using standard laboratory methods. The plasmid was constructed using the yeast homologous recombination method described in Example 1. [00419] These deletion plasmids for pep3 (pTTv188, pTTv 192 and pTTv205, Table 4.6) result in a 2590 bp deletion in the pep3 locus and cover the complete coding sequence of PEP3. Table 4.6: Primers for generating pep3 deletion plasmids. Deletion plasmid pTTv188 for pep3 (TreID121133), vector backbone pRS426 Primer Sequence T346_pep35jffor GGTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACGTCGA GCCCCCTGGACACCT (SEQ ID NO: 385) T347_pep3_5fjrev GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCG GCCGCCATCGCCGTCGCGGACATGA (SEQ ID NO: 386) T348_pep3loopfor TGATTGTACCCCAGCTGCGATTGATGTGTATCTTTGCATGGCGG CCGCTCGACGTTGTATCTGCACTC (SEQ ID NO: 387) T349_pep3_ooprev GTACGTTCTGATTGCCAACTACGGACCAGACCAGGGCTCCGGC GCGCCCATCGCCGTCGCGGACATGA (SEQ ID NO: 388) T350_pep3_3f for GGAGCCCTGGTCTGGTCCGT (SEQ ID NO: 389) T351_pep3_3fjrev AGCGGATAACAATTTCACACAGGAAACAGCGTTTAAACACGCG CTTCAACATGCCCCA (SEQ ID NO: 390) Deletion plasmid pTTvl92 for pep3 (TreID121133), vector backbone pTTvl88 Primer Sequence T389_cDNApromoterpep3flan GCTGGCCGCTGGGAATAGCGTCATGTCCGCGACGGCGATGGAA k TTCGGTCTGAAGGACGT (SEQ ID NO: 391) T138_cDNA1_Rev GTTGAGAGAAGTTGTTGGATTG (SEQ ID NO: 392) T139_123561ForcDNA1 AACCAAAGACTTTTTGATCAATCCAACAACTTCTCTCAACATGA AGATTTCCTCGATCCTTG (SEQ ID NO: 393) 123561Rev TCAGCGCCGTAACCTCTGC (SEQ ID NO: 394) 137 WO 2013/102674 PCT/EP2013/050126 trpCtermFor_123561 TGATGGTGATGAGGCGGAAAAGCAGAGGTTACGGCGCTGAGGA TCCACTTAACGTTACTGA (SEQ ID NO: 395) T390_trpCtermRAmdS TCTCTCAAAGGAAGAATCCCTTCAGGGTTGCGTTTCCAGTGCGG CCGCTCTCCTTCTAGAAAGAAGGATTA (SEQ ID NO: 396) T391_AmdSendR ACTGGAAACGCAACCCTGAA (SEQ ID NO: 397) T390_trpCtermRAmdS TCTGATTGCCAACTACGGACCAGACCAGGGCTCCGGCGCGGCG GCCGCTAGATCTACG (SEQ ID NO: 398) Deletion plasmid pTTv205 for pep3 (TreID121133), vector backbone pTTv192 Primer Sequence T428_pep3_3flankDRF- GTACACTTGTTTAGAGGTAATCCTTCTTTCTAGAAGGAGAGCGG trpCterm CCGCGGAGCCCTGGTCTGGTCC (SEQ ID NO: 399) T429_pep3_3flankDRR-pyr4 GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGAAG CTGACGGGCGTCAACG (SEQ ID NO: 400) T094_pyr4_F TAGCATCGACTACTGCTGC (SEQ ID NO: 401) T430_pyr4_R-pep3_3flank GTACGTTCTGATTGCCAACTACGGACCAGACCAGGGCTCCGCG GCCGCCATGCAAAGATACACATCAATC (SEQ ID NO: 402) Generation of 7-fold protease deletion strains [00420] To generate a marker-free 7-fold protease deletion strain, removal of the pyr4 marker was applied to the 6-fold deletion strain M396 essentially as described in Example 3 for removal of the pyr4 blaster cassette from the strain M195 (Apepl). Four consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. [00421] Final clones were verified by PCR using the primers listed in Table 4.7 with standard laboratory methods. Signal corresponding to successful removal of the blaster cassette was obtained. Removal of the blaster cassette was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. No growth was observed on the plates without uridine supplementation. Southern analyses of four putative pyr4- clones verified the removal of the blaster cassette for all clones (Fig. 34E). The clone (25-120A-62) used to generate the 7-fold protease deletion strain was designated with strain number M402 (ApeplAtsplAslplAgaplAgap2Apep4, pyr4 ). [00422] Two parallel transformations were carried out; one with the deletion construct from pTTv188 (standard pep3 deletion) and the other with pTTv205 (KEX2 overexpression included). To remove vector sequence, plasmids pTTv188 and pTTv205 were digested with PmeI and the 138 WO 2013/102674 PCT/EP2013/050126 correct fragments purified from agarose gel using QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of either deletion cassette was used to transform M402 (Apep1Atsp1Aslp1Agap1Agap2Apep4, pyr4-). Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00423] Transformants were picked as first streaks. Growing streaks were screened by PCR (using the primers listed in Table 4.7) for correct integration. Clones giving the expected signals were purified to single cell clones and rescreened by PCR using the primers listed in Table 4.7. [00424] Deletion of pep3 was verified by Southern analyses from selected clones using methods described in Example 1. Chosen clones were used for removal of the pyr4 blaster cassette, and in generation of the 8-fold protease deletion strains (Fig. 34E). Table 4.7: Primers for screening removal of pyr4 blaster cassette from M396 and for screening pep3 integration and strain purity. For screening removal of pyr4 blaster cassette from M396 Primer Sequence T302_77579_5int GATTCATCACAGGGGCAGTC (SEQ ID NO: 403) T214_pep4_3fseqrl CCGCTCTCAAACTGCCCAAA (SEQ ID NO: 404) For screening integration of pTTv188 Primer Sequence T625_pep3_5int new ACGTGAAGTTGCCCATCAA (SEQ ID NO: 405) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 406) T626_pep3_3int new GACCAATGGCTTCACGAAGT (SEQ ID NO: 407) T061_pyr4orfscreen_2F TTAGGCGACCTCTTTTTCCA (SEQ ID NO: 408) For screening integration of pTTv205 Primer Sequence T625_pep3_5int new ACGTGAAGTTGCCCATCAA (SEQ ID NO: 409) T140_cDNAlpromoter-seqRl TAACTTGTACGCTCTCAGTTCGAG (SEQ ID NO: 410) T626_pep3_3int new GACCAATGGCTTCACGAAGT (SEQ ID NO: 411) T061_pyr4_orfscreen_ TTAGGCGACCTCTTTTTCCA (SEQ ID NO: 412) 2F For screening deletion of pep3 ORF Primer Sequence T352_pep3orfbfor CAGCAGCACCGCATCCACCA (SEQ ID NO:413) 139 WO 2013/102674 PCT/EP2013/050126 T353_pep3_orf rev GCCGAATCGCTGGTTGCCCT (SEQ ID NO: 414) T753_pep3_orf for2 ATGGAAGCCATCCTCCAGG (SEQ ID NO: 415) T754_pep3_orf rev2 TGGATCATGTTGGCGACG (SEQ ID NO: 416) T855_pep3_orf_f3 GTAAGACGCCCCGTCTC (SEQ ID NO: 417) Generation of 8-Fold Deletion Strain [00425] The 8-fold protease deletion strain having deletions ApeplAtsplAslpAgapAgap2Apep4Apep3Apep5 is generated. Generation of pep5 deletion plasmid [00426] The first deletion plasmid for the eighth protease gene, aspartic protease pep5 (TreID81004) was constructed essentially as described for the Apep1 plasmid pTTv41 in Example 1, but an additional second selection marker cassette (bar, Example 1) was placed after the pyr4 gene creating a deletion plasmid with a double selection marker blaster cassette. The double marker system enables a) utilisation of e.g. bar (or hph, a cassette for hygromycin resistance) as the initial resistance marker and faster selection; b) transformation of pyr4* strains (without the need to generate pyr4- prior to transformation); and c) removal of both markers from the transformants using 5-fluoroorotic acid (like in removal of standard pyr4 blaster cassette) and simultaneous mutagenization of the endogenous pyr4 resulting in marker-free, pyr4- strain. [00427] The second deletion plasmid for the aspartic protease pep5 (TreID81004), pTTv229, was constructed using the plasmid pTTv202 above as the backbone. The pyr4-bar double marker was removed from pTTv202 with NotI digestion. The pyr4 marker gene was obtained from pTTv181 with NotI digestion. Cloning of the plasmid pTTv229 was done with standard ligation using T4 DNA ligase at room temperature. Part of the ligation mixture was transformed into E. coli with electroporation. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct ligation using standard laboratory methods. Correct ligation and orientation of the marker was further verified by sequencing. These deletion plasmids for pep5 (pTTv202 and pTTv229, Table 4.8) result in a 1687 bp deletion in the pep5 locus and cover the complete coding sequence of PEP5. 140 WO 2013/102674 PCT/EP2013/050126 [00428] 1348 bp of 5' flanking region and 1164 bp of 3' flanking region were selected as the basis of the pep5 deletion plasmid. A 300 bp stretch from the end of pep5 5' flank was used as the direct repeat fragment. These fragments as well as the second selection marker cassette, bar (Example 1), were amplified by PCR using the primers listed in Table 4.8. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. To enable removal of the complete double marker cassette, Nod restriction sites were introduced on both sides of the double marker cassette, and an AsiSI site between the two selection markers. An AscI site was introduced between the pep5 5'direct repeat and 3' flank. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The pyr4 selection marker was obtained from pTTv 181 (Apep4-pyr above) with Nod digestion. The plasmid was constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for pep5 (pTTv202, Table 4.8) results in a 1687 bp deletion in the pep5 locus and covers the complete coding sequence of PEP5. Table 4.8: Primers for generating pep5 deletion plasmid. Deletion plasmid pTTv202 for pep5 (TreID81004), vector backbone pRS426 Primer Sequence T372_pep55jffor GGTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACGGAGG CTGCGACACCGTCTG (SEQ ID NO: 418) T373_pep5_5fjrev GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCG GCCGCCCGGCCTGAAACGACCTCCC (SEQ ID NO: 419) T376_pep5_5DRjfor CCCGTCACCGAGATCTGATCCGTCACCGGGATCCACTTAAGCGG CCGCGAGAGAGAAACAAAACAGTG (SEQ ID NO: 420) T377_pep5_5DR-rev ACATTCCGACCGTTTACTGATCCAAGCCGTGCAACCGACTGGCG CGCCCCGGCCTGAAACGACCTCCC (SEQ ID NO: 421) T378_pep5_3f for AGTCGGTTGCACGGCTTGGA (SEQ ID NO: 422) T379_pep5_3fjrev AGCGGATAACAATTTCACACAGGAAACAGCGTTTAAACGAGAC GGACGCCTGCACCAC (SEQ ID NO: 423) T374_barrecpyr4_for2 TGATTGTACCCCAGCTGCGATTGATGTGTATCTTTGCATGGCGA TCGCGACAGAAGATGATATTGAAG (SEQ ID NO: 424) T375_barrev TTAAGTGGATCCCGGTGACG (SEQ ID NO: 425) Deletion plasmid pTTv229 for pep5 (TreID81004), vector backbone pTTv202 Primer Sequence no new primers, pTTv202 digested with NotI and ligated with pyr4 fragment from pTTv181 141 WO 2013/102674 PCT/EP2013/050126 Generation of 8-fold protease deletion strain [00429] To generate a marker-free 8-fold protease deletion strain, removal of the pyr4 marker was applied to the 7-fold deletion strain M486 (34-14A-a, pTTv205 in M402) essentially as described in Example 3 for removal of the pyr4 blaster cassette from the strain M195 (Apep1). Four consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. [00430] Final clones were verified by PCR using the primers listed in Table 4.9 with standard laboratory methods. Signal corresponding to successful removal of the blaster cassette was obtained for majority of the clones. Removal of the blaster cassette was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. No growth was observed on the plates without uridine supplementation. Southern analyses of putative pyr4 clones verified the removal of the blaster cassette. [00431] To remove vector sequence, plasmid pTTv229 was digested with PmeI + XbaI and the correct fragment purified from an agarose gel using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the deletion cassette was used to transform a clone of 8-fold protease deletion strain (Apep1Atsp1Aslp1Agap1Agap2Apep4Apep3, pyr4-). Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M1 95 using pyr4 selection. [00432] Transformants were picked as first streaks. Growing streaks are screened by PCR (using the primers listed in Table 4.9) for correct integration. Clones giving the expected signals are purified to single cell clones and rescreened by PCR using the primers listed in Table 4.9. Deletion of pep5 is verified by Southern analyses from selected clones using methods described in Example 1. 142 WO 2013/102674 PCT/EP2013/050126 Table 4.9: Primers for screening removal of pyr4 blaster cassette from 7-fold strain and for screening pep5 integration and strain purity. For screening removal of pyr4 blaster cassette from M486 and strain purity Primer Sequence T047_trpC-term end F CCTATGAGTCGTTTACCCAGA (SEQ ID NO: 426) T854_pep3_3f r2 TGGCCGAGTCTATGCGTA (SEQ ID NO: 427) T488_pyr45utr rev GGAGTTGCTTTAATGTCGGG (SEQ ID NO: 428) T061_pyr4orf screen 2F TTAGGCGACCTCTTTTTCCA (SEQ ID NO: 429) T855_pep3orff3 GTAAGACGCCCCGTCTC (SEQ ID NO: 430) T754_pep3orf rev2 TGGATCATGTTGGCGACG (SEQ ID NO: 431) For screening integration of pTTv229 Primer Sequence T627_pep5_5int new GTCGAAGATGTCCTCGAGAT (SEQ ID NO: 432) T488_pyr45utr rev GGAGTTGCTTTAATGTCGGG (SEQ ID NO: 433) T061_pyr4orf screen 2F TTAGGCGACCTCTTTTTCCA (SEQ ID NO: 434) T628_pep5_3intnew TAGTCCATGCCGAACTGC (SEQ ID NO: 435) For screening deletion of pep5 ORF Primer Sequence T418_pep5orf for CCGGACCTGCACCGCAAGTT (SEQ ID NO: 436) T419_pep5orf rev AGGGCAATGTCGCCCAGCAC (SEQ ID NO: 437) T859_pep5orf f2 GACCTGCACCGCAAGTT (SEQ ID NO: 438) T860_pep5_orf_f3 GTCGAGCGTCTGATATTCAC (SEQ ID NO: 439) T861_pep5orf r2 GACGGAGACCTCCCACA (SEQ ID NO: 440) Example 5 - IMPROVED ANTIBODY PRODUCTION WITH PROTEASE INHIBITORS [00433] This example demonstrates the ability of protease inhibitors to increase full length antibody production in Trichoderma reesei production strains. [00434] Based on the knowledge that the heavy chain is cleaved by tryptic and chymotryptic proteases, inhibitors of these two enzyme classes were tested against antibody degradation both in vitro and in culture experiments utilizing an antibody producing T. reesei strain. The inhibitors soybean trypsin inhibitor (SBTI) and chymostatin were tested, as they have been previously shown in in vitro experiments to stabilize antibody heavy chains. 143 WO 2013/102674 PCT/EP2013/050126 In vitro Inhibitor Treatment [00435] Chymostatin and SBTI were analyzed in vitro with culture supernatant. Supernatant from a fed batch fermentor culture was diluted to 6 mg/ml with sodium citrate buffer pH 5.5 (pH 5,5; 28 0 C; 20 g/L spent grain extract, 60 g/L lactose). The fedbatch cultivation was performed with the T. reesei wild type strain M44, which does not contain heterologous protein expression. The strain was grown in Trichoderma minimal medium supplemented with 20 g/l spent grain extract and 60 g/l lactose at pH 5.5 and 28 0 C. [00436] To this diluted supernatant 0.05 [g/tl of rituximab, 100 pM chymostatin, 1 mg/ml SBTI, or a combination of both inhibitors was added in a total volume of 50 [I and sampled at 0, 1, and 19 hours to assess the early and late degradation of the rituximab antibody heavy chain. The resulting heavy chain products were analyzed by immunoblot using and anti-heavy chain AP conjugated antibody (Sigma #A3188) diluted 1:30,000 in TBST (Fig. 35). The initial degradation products generated from the heavy chain were approximately 42 kDa and 38 kDa, which were seen in the untreated control lane at 1 hour (Fig. 35). Additional fragments were generated after 19 hours, the two major products remained. Chymostatin treatment inhibited the initial production of the 42 kDa fragment, while SBTI treatment inhibited the 38 kD fragment from forming (Fig. 35). Combining the two compounds inhibited about 96% of the initial heavy chain degradation and about 75% of the degradation after 19 hours (Fig. 35). These results demonstrate that the two inhibitors were able to effectively stabilize the rituximab antibody heavy chain. Treatment of T. reesei Cultures with Inhibitors [00437] The effectiveness of the inhibitors was also tested with the rituximab antibody producing strain, which contains a VALEKR linker sequence and the pep] deletion. This strain was grown in triplicate, in small flasks both in presence or absence of chymostatin, SBTI, or pepstatin A. The small shake flasks contained 50 ml of TrMM plus lactose (40 g/l), spent grain extract (20 g/1), and buffer with 100 mM PIPPS at pH 5.5. The SBTI inhibitor was added to the culture at final concentrations of either 100 p g/ml or 500 p g/ml. Chymostatin was used at 100 144 WO 2013/102674 PCT/EP2013/050126 pM, and pepstatin A was used at 10 pM. Each of the three inhibitors was added to the cultures daily on day 2, 3, 4, and 5. [00438] Growth of the cultures was followed daily by pH from day 2 until day 7. For the cultures grown with SBTI there were no significant differences in the pH of the cultures compared to the untreated controls. In the PIPPS buffered cultures, the pH decreased from an initial pH of 5.5 down to a pH of 4.8 after day 6. With chymostatin and pepstatin A the cultures were monitored up to day 7. On day 7 the average pH for the control bottles was 4.6, while the average pH for chymostatin treated cultures was 4.9, and the average pH of pepstatin A treated cultures was 5.0. Thus, for the cultures treated with chymostatin and pepstatin A there was a small reduction in growth. [00439] Culture supernatant samples (30 l) were also collected on days 3, 4, and 5 for analysis of antibody production. The analysis was performed by immunoblots using an anti-IgG heavy chain antibody AP conjugate (Sigma #A3188) and an anti-light chain antibody AP conjugate (Sigma #A3812). Each antibody was diluted 1:30,000 in TBST. The full length rituximab heavy chain is about 51 kD, the rituximab light chain CHBI fusion is about 100 kD, and the free rituximab light chain is about 28 kD. [00440] Results of immunoblot analysis of culture supernatant samples treated with SBTI are shown in Figure 36. On all days sampled there was more full length rituximab heavy chain and more 38 kD degradation product present in the SBTI treated cultures than in untreated cultures. On day 5 rituximab heavy chain production was several fold higher in the SBTI treated cultures than in untreated cultures (Fig, 36A). Thus, the use of SBTI had a positive effect on improving rituximab heavy chain production. There was also a minor improvement in overall rituximab light chain production, particularly with the carrier bound light chain (Fig. 36B). [00441] Results of immunoblot analysis of culture supernatant samples treated with chymostatin and pepstatin A are shown in Figure 37. Chymostatin treated cultures showed similar results as those seen with SBTI (Fig. 37). The rituximab heavy chain was stabilized on day 5 (Fig. 37B). When compared to the untreated control cultures, chymostatin increased the 145 WO 2013/102674 PCT/EP2013/050126 amount of full length rituximab heavy chain produced, although there the major degradation product at 38 kD was still seen. [00442] Overall, it appears that SBTI treatment was more effective in promoting higher protein production than chymostatin treatment. However, chymostatin treatment produced a higher full length rituximab heavy chain to fragment ratio. As seen in Figure 37B, the third chymostatin culture sample showed approximately 90% full length rituximab heavy chain compared to 10% heavy chain fragment. Thus, the combination of SBTI and chymostatin treatment would be very beneficial to achieving higher antibody production yields. Example 6 - T. REESEI ANTIBODY PRODUCTION [00443] This example quantifies the amount of antibodies produced in the T. reesei protease deletion strains described above in Examples 1-4. Antibody Purification [00444] Culture supernatants from each of the T. reesei protease deletion strains listed in Table 6.1 were filtered through 0.45 tm syringe filter and adjusted to the composition of binding buffer by adding 1/50 volume of 1 M sodium phosphate, pH 7, prior to purification. The affinity column was connected to an AKTA Purifier, and the purification was performed according to the manufacturer's instructions. The following chromatography conditions were used: flow rate, 1 ml/min; detection 280 nm; injection loop, 5 ml; buffer A, 20 mM sodium phosphate, pH 7; buffer B, 0.1 M glycine-HCl, pH 2.7. Isocratic run with buffer A was conducted until the start of the elution, which was carried out with 5 ml of buffer B. The column was equilibrated at least with 5 ml of buffer A prior to each analysis. 1 ml of culture supernatant was injected for quantitative runs. 0.5 ml fractions were collected into tubes containing 40 1tl of 0.5 M Tris, pH 9, during the elution step. Antibody was eluted sharply in two fractions, which were pooled into one sample of 1 ml. From the samples with the highest peak areas among each sample series (fermentation), one run with 5-10 ml injection volume was performed to obtain more concentrated sample for gel filtration analysis. 146 WO 2013/102674 PCT/EP2013/050126 [00445] For quantification, a series of dilutions was prepared of antibody standard and run in 1 ml volume in HiTrap Protein G column similarly to the samples analyzed. A standard curve (10 500 rig) was established of the peak areas measured at 280 nm and used for the quantification of the MABO 1 or rituximab antibodies isolated from the culture supernatants. The quality of the purified samples was checked by SDS-PAGE. Gel Filtration Profiles of Prot G Purified Samples [00446] A 250 1tl sample of each purified MABO and rituximab antibody was run in Tris buffered saline (25 mM Tris, 140 mM NaCl, and 3 mM KCl, pH7.4) in a Superdex 200 10/300 GL gel filtration column (Amersham Biosciences) connected to an AKTA Purifier HPLC system. The flow rate was 0.75 ml/min and absorbance was measured at 280 nm. Fractions (0.75 ml) were collected during the whole run. The fractions showing only one peak were concentrated and characterized on a standard SDS-PAGE gel (Fig. 38). The percentage of each peak eluted was calculated by dividing the peak area with the total area of the sample measured at 280 nm. [00447] The antibody purification process is shown in Figure 38. Antibody Quantification [00448] The amounts of antibodies produced by the T. reesei protease deletion strains are summarized in Table 6.1. Table 6.1: Summary of quantity and quality of antibodies produced by crude fermentor supernatant cultures from T. reesei strains described in Examples. Total amount Total amount Notes/Conditions Heterologous of mAb of full length protein Aprotease Culture (mg/L) mAb (mg/L) MAB02 none shake flask 3 n/a Rituximab none shake flask 9 n/a strain M187; pH 5,5; 28'C; 9 g/l casaminoacids; 20 g/L spent grain extract, 60 Rituximab none fermentation 21 n/a g/L lactose 147 WO 2013/102674 PCT/EP2013/050126 Total amount Total amount Notes/Conditions Heterologous of mAb of full length protein Aprotease Culture (mg/L) mAb (mg/L) Rituximab none shake flask 3 n/a strain M189 pH 4,8; 28'C; 9 g/l casaminoacids; 20 g/L spent grain extract, 60 MABO pepI fermentation 160 3 g/L lactose Rituximab pepI fermentation 152 66 pH 5,2; 22'C; 9 g/l 237 n/a casaminoacids; 20 g/L spent grain extract, 60 g/L lactose and pH 5,2; 30->22'C; 40 g/L spent grain, 60 g/L glucose pH 5,2; 22'C; 9 g/l casaminoacids; 20 g/L spent grain extract, 60 MABO pep1, tsp1 fermentation 67 n/a g/L lactose strain M244; pH 5,5; 28->22'C; 9 g/L casaminoacids; 20 g/L spent grain extract, 60 g/L lactose + Chymostatin+SBTI; MABO pepI fermentation 205 n/a Carrier free LC. strain M247; pH 5,5; 22'C; 9 g/l casaminoacids; 20 g/L spent grain extract, 60 MABO pepI tsp1 fermentation 261 <130 g/L lactose MABO pepI sip2 fermentation 202 60 strain M292; pH 5,5; 221 67 30->22'C; 20 g/L spent grain extract, 60 g/L lactose or pH 5,5; 30 >22'C; 40 g/L spent grain, 30 g/L glucose strain M295; pH 5,5; 22'C; 9 g/L casaminoacids; 20 g/L spent grain extract, 60 MABO pepI sIp3 fermentation 93 n/a g/L lactose pH 5,5; 22'C; 9 g/L casaminoacids; 20 g/L MABO pepI gapI fermentation 107 n/a spent grain extract, 60 148 WO 2013/102674 PCT/EP2013/050126 Total amount Total amount Notes/Conditions Heterologous of mAb of full length protein Aprotease Culture (mg/L) mAb (mg/L) g/L lactose strain M298; pH 5,5; 28->22'C; 9 g/L casaminoacids; 20 g/L spent grain extract, 60 MABO pep1 sip1 fermentation 136 19 g/L lactose strain M299; pH 5,5; 22'C; 9 g/L casaminoacids; 20 g/L spent grain extract, 60 MABO pep1 sIp1 fermentation 94 n/a g/L lactose MABO pep1 tspl fermentation 2159 1471 strain M304; pH 5,5; sIp 1 3500 2500 30->22'C; 40 g/L spent 1200 822 grain, 40 g/L glucose, 1344 731 40 g/L lactose or pH 5,5; 28->22'C; 60 g/L spent grain, 30 g/L glucose, 60 g/L lactose + lactose feed or pH 5,5; 30->22'C; 50 g/L spent grain, 30 g/L glucose or pH 5,5; 30 >22'C; 40 g/L spent grain, 40 g/L glucose, 40 g/L lactose MABO pep1 tspl fermentation 1965 897 strain M371; pH 5,5; sIpI gapI 30->22'C; 40 g/L spent grain, 40 g/L glucose, 40 g/L lactose [00449] In Table 6.1, the total amount of antibody (mAb) is the amount of protein that was purified from the culture supernatant. After protein purification, the antibody was run in size exclusion chromatography to measure the amount of full length assembled antibody. This amount was then referred to as "Full mAb." [00450] As shown in Table 6.1, the M304 triple deletion strain (Apep1 Atsp1Aslpl) achieved an antibody yield of 3500 mg/L total IgG, with 2500 mg/L being correctly assembled into full 149 WO 2013/102674 PCT/EP2013/050126 length MABO antibody. This corresponds to 71% of full length antibody. The improvement in the percentage of full length antibody was a result of the sip] deletion. In contrast to the M304 strain, the M247 double deletion strain (Apep1Atsp1) achieved a 43% production yield of full length antibody (pH 5,5; 22'C; 9 g/l casaminoacids; 20 g/L spent grain extract, 60 g/L lactose). Thus, it can directly be seen that the addition of the Aslp] deletion increases the product quality significantly (by 25%). Antibody quality improvement in M507 MAB01 production strain [00451] Two MABO production strains were produced, M304 in a 3 protease deletion background and M507 in a 7 protease deletion background. The M304 strain was constructed with separate cassettes for the heavy and light chain (Figure 49). The heavy chain was integrated into the cbh] locus and the light chain into the egl] locus. The M507 strain was made by integrating a tandem cassette containing both the heavy and light chain into the CBHI locus (Figure 49). MABO tandem vector orients the heavy and light chains in opposite directions. The light chain uses the NVISKR cleavage site and the heavy chain uses the DGETVVKR cleavage site. The M304 strain has 3 proteases pep], tsp], and sip] deleted. The M507 has 7 proteases pep], tsp], sip], gap], gap2, pep4, pep3 deleted. Both strains overexpress kex2 protease. [00452] The MABO bidirectional tandem vector pTTv223 was transformed to the seven-fold protease deletion strain M486 with kex2 overexpression using standard protoplast transformation. Transformants were selected on acetamide-triton plates and first streaks were PCR screened for the 5' and 3' integration of the AmdS marker to the cbh] locus. Double positive transformants were purified through single spore cultivations and spore stocks were generated on PD plates supplemented with ampicillin. [00453] The M304 and M507 strains were cultivated in fermentors with 30 g/l glucose, 60 g/l spent grain, 60 g/l lactose with lactose feed at 28'C and shifted to 22'C later in the culture. The M507 strain was cultivated at pH 5.2 (cultivation bio00541b) and pH 5.5 (cultivation bio00543b). The M304 strain was grown at pH 5.5 (cultivation bio00503b). The M304 fermentation 150 WO 2013/102674 PCT/EP2013/050126 bio00477b sample was included as a control in the bio00503b immunoblot. The bio00477b cultivation was done with the same medium and conditions as described for bio00503b. [00454] The M507 strain was cultivated at both pH 5.2 and pH 5.5 to study the effect of the pH on antibody production. Supernatant samples from the pH 5.2 fermentation were analyzed by Western blot and shown in Figure 50A and samples from the pH 5.5 fermentation shown in Figure 50B. The antibody produced looked rather similar in both M507 cultivations. There was somewhat more light chain in the pH 5.2 conditions. In both cultivations there were heavy chain fragments. The M304 strain was cultivated at pH 5.5 and the results can be seen in Figure 51. The amount of full length heavy chain produced drops off after day 7 in the M304 strain. The amount of heavy chain goes down after day 9 in the M507 strain. The other difference between the strains was the amount of light chain produced. The M304 produced significantly more. [00455] Protein G purified immunoglobulin concentrations from the three fermentation runs can be seen in Table 6.2. The highest total antibody concentration for the M304 strain was 3.1 g/l on day 9. The highest concentrations for the M507 strain were at day 10, 3.0 g/l at pH 5.2 and 2.8 g/l at pH 5.5. After size exclusion chromatography the amount of full-length antibody was calculated for each sample (Table 6.3). The highest full-sized antibody amount was 2.0 g/l for both M507 fermentations at day 8 (pH 5.2) and day 9 (pH 5.5). The M304 produced a similar 2.0 g/l level of full-length antibody on day 8. Table 6.2: Total antibody concentration determined after protein G purification from culture samples Total Ab M304 M507 M507 bio00503b bio00541b bio00543b pH 5.5 pH 5.2 pH 5.5 Day mg/L mg/L mg/L 5 2300 1200 1164 6 2800 1427 1454 7 3000 2211 2116 8 3000 2745 2455 9 3100 2721 2709 10 2100 2995 2808 151 WO 2013/102674 PCT/EP2013/050126 11 2702 2164 [00456] The difference between the M304 and M507 strains becomes obvious when considering the percentage of full-length antibody produced over the time course of the cultivations. The percentage of full-length antibody was higher with the M507 compared to the strain M304. The M507 strain grown at pH 5.5 produced the highest quality antibody, up to 78% being full-length on day 7. The M304 reached 68% on day 6, but then the product quality decreases compared to M507. The M507 product was 73% full-length until day 9. Table 6.3: The concentration of full-length antibody was calculated after size exclusion chromatography Full sized Ab M304 M507 M507 bio00503b bio00541b bio00543b pH 5.5 pH 5.2 pH 5.5 Day mg/L mg/L mg/L 6 1900 1062 1074 7 2000 1557 1645 8 2000 1998 1859 9 1700 1924 1988 10 900 1871 1806 Table 6.4: Percentage of full-length antibody produced over the time course of the cultivations. Full sized % M304 M507 M507 bio00503b bio00541b bio00543b pH 5.5 pH 5.2 pH 5.5 Day % % % 6 68 74 74 7 67 70 78 8 60 73 76 9 56 71 73 10 44 62 64 152 WO 2013/102674 PCT/EP2013/050126 Protease activity measurements [00457] The protease activity in the supernatant was compared between the M304 and M507 strains grown under the same conditions. The Triab62 and Triab67 cultivations were grown at pH 5.5 in 30 g/l glucose, 60 g/l lactose, 20 g/l whole spent grain, 20 g/l spent grain extract with lactose feed at 28'C and shifted to 22'C later in the culture. [00458] The protein concentrations were determined from all supernatant samples from day 2 7. All the supernatants were diluted in sodium citrate buffer pH 5.5, so that all the samples had a total protein concentration of 0.625 mg/ml. 100 l of all the diluted supernatants were added into a black 96 well plate, using 3 replicate wells per sample. 100 PI of casein FL diluted stock (10 pg/ml) made in sodium citrate buffer pH 5.5 was added to each supernatant containing well. The plates were incubated covered in plastic bag at 37 0 C. The fluorescence from the wells was measured after 2, 3, and 4 hours. The readings were done on the Varioskan fluorescent plate reader using 485 nm excitation and 530 nm emission. [00459] The protease activity in supernatant from the 7-fold protease deletion strain M507 was 2- to 2.5- times lower than M304 (3 protease deletions), see Table 6.5. The acidic proteases deleted (gap1, gap2, pep4, pep3) contribute to this improvement. The general protease activity in the 7-fold deletion strain is noticeably lower with the casein substrate. This data generally correlates to the results seen with percentage full length antibody. Lower protease activity leads to higher quality antibody. Table 6.5: Protease activity in fermentation supernatant from pH 5.5 cultures. Casein was used as the substrate for the measurements. M304 M507 Triab62 Triab67 Day pH 5.5 pH 5.5 1 1,4 1,3 2 8,5 1,8 3 67,4 4,1 4 98,8 38,8 5 102,3 48,3 153 WO 2013/102674 PCT/EP2013/050126 6 83,3 54,6 7 103,1 54,5 8 109,8 55,3 9 120,9 61,1 10 134,9 70,0 11 148,0 76,2 Example 7 - PRODUCTION OF NON-ANTIBODY PROTEINS [00460] The protease stability of the model proteins IGF1, hGH, and IFNa2b were analyzed by spiking them into supernatant from the 6-fold protease deletion strain (Apep1Atsp1Aslp1Agap1Agap2Apep4) M400. The supernatant was collected from a large shake flask culture CAH 15. The undiluted supernatant from the shake flask cultivation CAH 15 was incubated with the purified model proteins with and without pepstatin A (50 PM) and SBTI (0.2 mg/ml) inhibitors for 20 hours at 37 0 C. The 5 day culture supernatant pH was around 4.2. The reaction containing 0.05 pg/pl of model protein was sampled after 20 hours. 50 mM sodium citrate pH 4.0 spiked with model proteins (0.05 tg/ Ll) was used as a buffer control. [00461] From each reaction 10 l was loaded into an 18% SDS PAGE gel and run for 30 minutes at 200 V. The proteins in the gel were then transferred to nitrocellulose for immunoblotting. The nitrocellulose membrane was blocked for 1 hour at room temperature with 5% milk in TBST buffer. The individual blots were probed with their specific primary antibody to detect the appropriate model protein for 1 hour at room temperature on a shaker. The mouse anti-IGF1 antibody (R&D systems #mab291) was used at 2 pg/ml diluted in TBST. The mouse anti-rhGH antibody (Abcam #ab51232) was used at 2 p g/ml diluted in TBST. The mouse anti IFNa2b antibody (Abcam #ab9386) was used at 1 pg/ml diluted in TBST. After briefly washing the blot membranes with TBST, the secondary antibody was added for 1 hour at room temperature shaking. The secondary goat anti-mouse AP conjugated antibody (Biorad #170 6520) was diluted 1:10,000 in TBST. [00462] When incubated overnight in supernatant, full length proteins were observed for hGH, IFNa2b, and IGF1, although the majority appeared to be degraded (Fig. 42). There was a 154 WO 2013/102674 PCT/EP2013/050126 predominate degradation product for human growth hormone and IFNa2b around 15 kD. However, these 3 model proteins were remarkably stabilized after treating the supernatant with the aspartic protease inhibitor pepstatin A. This inhibitor blocked the key proteases responsible for the majority of the protease activity. The SBTI provided only a small benefit for product stability. Although the pH optimum for SBTI is higher than used in the experiment (pH 4.2 vs. optimal pH 8.0) and thus the binding of these inhibitors to their target proteases may not be most efficient. [00463] Pepstatin A effectively inhibits aspartic proteases. It is known from affinity purification studies with pepstatin A that the remaining aspartic proteases in the supernatant are pep2, pep3, and pep5. Therefore, if the remaining 2 or 3 aspartic proteases were deleted the supernatant will be almost free of aspartic protease activity. For production of these model proteins, the aspartic proteases pep2, pep3, and pep5 would be considered major proteases. [00464] This same spiking experiment as was done with MABO to investigate its stability in the 6 protease deletion supernatant with and without inhibitors (Fig. 43). Samples were taken as described above and immunoblotted with an anti-heavy chain AP conjugated antibody (Sigma #A3188). After 20 hours incubation, there was no significant heavy chain degradation. There was no obvious benefit having used inhibitors. The antibody was stable in this pH 4.2 supernatant. The production of MABO under more acidic conditions, such as pH 4.5 would likely improve the production yield or at least decrease the amount of heavy chain cleavage that would occur. [00465] To evaluate what inhibitors would best stabilize production of hGH, 24 well cultures of these strains were performed. The M369 human growth hormone strain (Apep1Atsp1Aslp1Agap1Agap2) was grown along with single components or with combinations of the following: trypsin and subtilisin inhibitor SBTI, the acidic protease inhibitor peptide SIP, the acidic protease inhibitor peptide LIP, the aspartic protease inhibitor pepstatin A free peptide, pepstatin A immobilized to agarose beads, the trypsin and subtilisin inhibitor BBI from lima bean, the subtilisin inhibitor chymostatin, and BSA. Three independent wells were chosen for control wells where no inhibitors or supplements were added. These two strains were grown in 3 ml of TrMM with diammonium citrate without ammonium sulfate, 100 mM PIPPS, 20 g/L spent 155 WO 2013/102674 PCT/EP2013/050126 grain extract, 40 g/L lactose adjusted to pH 4.5. The 24 well plates were shaken at 800 rpm, 85% humidity, and 28 0 C. The cultures were grown for 6 days and covered with an air permeable membrane. [00466] Inhibitors were added first on day 1 and then daily beginning on day 3. 100 [I1 samples were taken from the culture wells beginning on day 3. The mycelium was spun down for 5 minutes at 13k and the supernatant collected. From the culture supernatant 12 [I was loaded in a 4-20% SDS PAGE gel and immunoblotting made on nitrocellulose with mouse anti-hGH antibody (2 p g/ml) and goat anti-mouse IgG AP conjugated secondary antibody diluted 1:10,000 in TBST. [00467] On day 4, the human growth hormone could still be seen in the culture supernatant in all the 3 control lanes (Fig. 44). Two of the control lanes show a faint band and one control lane shows a light band. The effect of the inhibitors and supplements was immediately observed. The inhibitor/supplements that had a big effect are highlighted in red and those with the best effect are starred. Pepstatin A had a negative effect on the growth hormone production. When used at 5 or 20 iM, production of the hGH seemed to be absent. It appears to have some toxic effect on the production. Only when the pepstatin was immobilized onto agarose beads was this effect negated. One of the best treatments was pepstatin A beads plus 0.2 mg/ml SBTI (see the third star on the blot in Figure 44). With only SBTI (0.2 mg/ml) there was improved production, but there was a large degradation band present at 18 kD that appears to be produced by the action of aspartic proteases. As expected, this degradation product was reduced by the addition of pepstatin A beads or the SIP peptide inhibitor. The SIP peptide was beneficial even when used alone at 20 or 50 pM. There was a noticeable increase in hGH amount when the SIP peptide was used, but the biggest improvement occurred when used in combination with SBTI or BSA. When chymostatin 5 pM and 25 pM were used it also improved the amount of full length product observed. Supplementing the culture with BSA (0.25%) alone aids production, but did not prevent the large degradation product from forming. [00468] Estimating the expression levels relative to the 200 ng control sample, the control wells produced between 3-6 mg/L of hGH, the BSA (0.25%)/SIP (50 pM)/SBTI (0.2 mg/ml) 156 WO 2013/102674 PCT/EP2013/050126 treatment produced 24.5 mg/L, the SIP (50 pM)/SBTI (0.2 mg/ml) treatment produced 26.6 mg/L, and the pepstatin A beads/SBTI (0.2 mg/ml) addition yielded 24.5 mg/L of hGH. Therefore, using a combination of inhibitors and additives worked best increasing the production levels by at least 4-fold. The critical parameter was to include an aspartic protease inhibitor into the mix. Example 8 - GENERATION OF PEP7 DEFICIENT T. REESEI [00469] The deletion plasmid for the aspartic protease pep7 (TreID5 8669) is constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. 1062 bp of 5' flanking regions and 1121 bp of 3' flanking region are selected as the basis of the pep7 deletion plasmid. Fragments are produced by PCR using the primers listed in Table 8.1. The products are separated with agarose gel electrophoresis and the correct fragments are isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. Template to be used in the PCR of the flanking regions is from the T. reesei wild type strain QM6a. The pyr4 blaster cassette is obtained from pTTv71 (Example 1) with Nod digestion. The vector backbone is EcoRI/XhoI digested pRS426 as in Example 1. The plasmid is constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for pep7 results in deletion in the pep7 locus and covers the complete coding sequence of PEP7 Table 8.1: Primers for generating pep7 deletion plasmids. Deletion plasmid for pep7 (TreID58669), vector backbone pRS426 Primer Sequence 5flankfw-pRS426 GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACCATAAACTTGCGCAGTC GAA (SEQ ID NO: 441) 5flankrev-pyr4 GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCGGCCGCCTTCT AGGATGGAGCGCTTG (SEQ ID NO: 442) 3flankfw-pyr4 CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGGCCGCAGACGG CTTCTTCCAAAACA (SEQ ID NO: 443) 3flankrev-pRS426 GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACCCCCAGGGAGGCTATTC TAC (SEQ ID NO: 444) For screening integration of pep7 deletion cassette Primer Sequence scrn_5forw CTTTCCAAGCGTTTGAGTCC (SEQ ID NO: 445) T026_Pyr4orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 446) 157 WO 2013/102674 PCT/EP2013/050126 scrn_3rev GCGTGTTTTATCCTGGTGCT (SEQ ID NO: 447) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 448) For screening deletion of pep7 ORF orf fw CACCTCCGTCGATGAGTTTT (SEQ ID NO: 449) orf rev AGAAGAAGGTGGTGGTGGTG (SEQ ID NO: 450) Example 9 - GENERATION OF SLP5 DEFICIENT T. REESEI [00470] The deletion plasmid for the aspartic protease slp5 (TreID64719) is constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. 1044 bp of 5' flanking regions and 1003 bp of 3' flanking region are selected as the basis of the slp5 deletion plasmid. Fragments are produced by PCR using the primers listed in Table 9.1. The products are separated with agarose gel electrophoresis and the correct fragments are isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. Template to be used in the PCR of the flanking regions is from the T. reesei wild type strain QM6a. The pyr4 blaster cassette is obtained from pTTv71 (Example 1) with Nod digestion. The vector backbone is EcoRI/XhoI digested pRS426 as in Example 1. The plasmid is constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for slp5 results in deletion in the slp5 locus and covers the complete coding sequence of SLP5. Table 9.1: Primers for generating sip5 deletion plasmids. Deletion plasmid for sip5 (TreID64719), vector backbone pRS426 Primer Sequence 5flankfw-pRS426 GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACGTTTGAGCATTCTCCCA AGC (SEQ ID NO: 451) 5flankrev-pyr4 GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCGGCCGCCGCCA TTTTGAAGAAGATGC (SEQ ID NO: 452) 3flankfw-pyr4 CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGGCCGCATGCTC CCTCGTCATTAAGC (SEQ ID NO: 453) 3flankrev-pRS426 GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACACAACACCTTCTCCGAC ACC (SEQ ID NO: 454) For screening integration of sip5 deletion cassette Primer Sequence scrn_5forw ATGCCCAAGTTTCGTACCTG (SEQ ID NO: 455) T026_Pyr4orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 456) 158 WO 2013/102674 PCT/EP2013/050126 scrn_3rev GGCGCATTCAGAAGAAGAAC (SEQ ID NO: 457) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 458) For screening deletion of sip5 ORF orf fw CACTTGATGAACGCTGGCTA (SEQ ID NO: 459) orf rev CGTAATGGCGTTGTTGACAG (SEQ ID NO: 460) Example 10 - GENERATION OF SLP6 DEFICIENT T. REESEI [00471] The deletion plasmid for the aspartic protease slp6 (TreID121495) is constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. 1192 bp of 5' flanking regions and 1114 bp of 3' flanking region are selected as the basis of the slp6 deletion plasmid. Fragments are produced by PCR using the primers listed in Table 10.1. The products are separated with agarose gel electrophoresis and the correct fragments are isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. Template to be used in the PCR of the flanking regions is from the T. reesei wild type strain QM6a. The pyr4 blaster cassette is obtained from pTTv71 (Example 1) with NotI digestion. The vector backbone is EcoRI/XhoI digested pRS426 as in Example 1. The plasmid is constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for slp6 results in deletion in the slp6 locus and covers the complete coding sequence of SLP6. Table 10.1: Primers for generating slp6 deletion plasmids. Deletion plasmid for slp6 (TreID121495), vector backbone pRS426 Primer Sequence 5flankfw-pRS426 GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACGAGGCAGCCAAAAAGT GAAG (SEQ ID NO: 461) 5flankrev-pyr4 GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCGGCCGCTGAAA GAAGGCAGGACCAGT (SEQ ID NO: 462) 3flankfw-pyr4 CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGGCCGCAAGAGG CTCGGACAAAGACA (SEQ ID NO: 463) 3flankrev-pRS426 GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACGATCGTGGTGCACGAG ACTA (SEQ ID NO: 464) For screening integration of slp6 deletion cassette Primer Sequence scrn_5forw GCACTGCGTTGCCTTTCTAT (SEQ ID NO: 465) T026_Pyr4orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 466) 159 WO 2013/102674 PCT/EP2013/050126 scrn_3rev GAAAGCATGGCTCGTTTCTC (SEQ ID NO: 467) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 468) For screening deletion of slp6 ORF orf fw ACCCGGCTCAACTAGCTACA (SEQ ID NO: 469) orf rev AGCTGGCCTTTCGTTACAGA (SEQ ID NO: 470) Example 11 - GENERATION OF SLP7 DEFICIENT T. REESEI Generation of slp7 Deletion Plasmid [00472] The deletion plasmid pTTv269 for the serine protease slp7 (tre123865) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1, except that the marker used for selection was pyr4-hgh from pTTv 194. [00473] 949 bp of 5' flanking region and 1025 bp of 3' flanking region were selected as the basis of the slp7 deletion plasmid pTTv269. These fragments were amplified by PCR using the primers listed in Table 11.1. Template used in the PCR of the flanking regions was from the T. reesei wild type strain QM6a. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The pyr4-hgh cassette was obtained from pTTv 194 (Apep4-pyr4-hgh) with NotI digestion. To enable removal of the marker cassette, NotI restriction sites were introduced on both sides of the cassette. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid pTTv269 was constructed with the 5' flank, 3' flank, pyr4-hgh marker, and vector backbone using the yeast homologous recombination method described in Example 1. This deletion plasmid for slp7 (pTTv269, Table 11.1) results in a 2019 bp deletion in the slp7 locus and covers the complete coding sequence of SLP7. Table 11.1: Primers for generating slp7 deletion plasmids. 160 WO 2013/102674 PCT/EP2013/050126 Deletion plasmid pTTv269 (Aslp7-pyr4-hgh), vector backbone pRS426 Primer Sequence T1088_s1p7_5flkfwvector GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACTCCCATA TGCCTCTTGAAGG T1089_slp7_5flkrevpyr4Prom GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCG GCCGCTTTGCAGCAAGATGTCGTTC (SEQ ID NO: 472) T1090_slp7_3flkfwpyr4oop CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGG CCGCTGGGTGATAAGCTTGGGTTT T1091_slp7_3flkrev_vector GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACATCATGA TGACCCATCGACA Example 12 -GENERATION OF SLP8 DEFICIENT T. REESEI Generation of slp8 Deletion Plasmid [00474] The deletion plasmid pTTv330 for subtilisin-like protease slp8 (tre58698) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1, except that the marker used for selection was a double marker pyr4-hph. [00475] 975 bp of 5' flanking region and 1038 bp of 3' flanking region were selected as the basis of the slp8 deletion plasmid. A 298 bp stretch from the end of slp8 5' flank was used as the direct repeat fragment. These fragments were amplified by PCR using the primers listed in Table 12.1. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The pyr4-hph cassette was obtained from pTTv2lO (Asep1-pyr4-hph) with Nod digestion. To enable removal of the complete double marker cassette, Nod restriction sites were introduced on both sides of the double marker cassette. AscI site was introduced between the slp8 5'direct repeat and 3' flank. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed using the yeast homologous recombination method described in Example 1.This deletion plasmid for slp8 (pTTv330, Table 12.1) results in a 1433 bp deletion in the slp8 locus and cover the complete coding sequence of SLP8. Table 12.1: Primers for generating slp8 deletion plasmid. Deletion plasmid pTTv330 (Aslp8-pyr4-hph), vector backbone pRS426 Primer Sequence 161 WO 2013/102674 PCT/EP2013/050126 T1203_s1p8_5f_f GATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACG GTTTAAACATCGTGCTTGGGCTATTCTG T1204_sp8_5f_r GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAG GCGGCCGCGGAAAGACGCCAGAAAGAAA T1205_s1p8_5dr_f GTACACTTGTTTAGAGGTAATCCTTCTTTCTAGAAGGAGA GCGGCCGCCGCTCGATGTGGATGATACT T1206_s1p8_5dr_r ATCTATACTGTCTGCACCAAAAGTACAACAACGCAAA CCGGGCGCGCCGGAAAGACGCCAGAAAGAAA T1207_s1p8_3f_f CGGTTTGCGTTGTTGTACTT T1208_sp8_3f_r TGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGC GTTTAAACACAACCCAACGTTCTCTCGT Example 13 - PROTEASE HOMOLOGS [00476] T. reesei pep], pep2, pep3, pep4, pep5, and pep7; tspl; sip], sip2, sip3, sip5, sip6, sip7, and slp8; gap] and gap2; and tpp] homologs were identified from other organisms. [00477] BLAST searches were conducted uisng the National Center for Biotechnology Information (NCBI) non-redundant amino acid database using the Trichoderma reesei protease amino acid sequences as queries. Alternatively, FASTA searches were conducted with the UniProt Knowledgebase of European Bioinformatics Institute (EBI). Trichoderma virens and Trichoderma atroviride BLAST searches were conducted using the DOE Joint Genome Institute's web site (Trichoderma virens Gv29-8 v2.0 and Trichoderma atroviride v2.0, respectively). Sequence hits from the BLAST searches were aligned using the ClustalW2 alignment tool provided by EBI. Phylogenetic trees were also generated using the sequence alignments. [00478] Figures 45 depicts a phylogenetic tree of aspartic proteases of selected filamentous fungi. [00479] Figure 46 depicts a phylogenetic tree of subtilisin proteases of selected filamentous fungi. [00480] Figure 47 depicts a phylogenetic tree of glutamic proteases of selected filamentous fungi. 162 WO 2013/102674 PCT/EP2013/050126 [00481] Figure 48 depicts a phylogenetic tree of sedolisin proteases of selected filamentous fungi. Example 14 - GENERATION OF 9-FOLD PROTEASE DELETION STRAINS Generation of 9-fold Protease Deletion Strain Having Deletions Apep1Atsp1 Aslp 1Agap 1 Agap2Apep4Apep3Apep5Apep2 Generation of new pep2 deletion plasmids [00482] The first deletion plasmid, pTTv213, for the aspartic protease pep2 (tre0053961) was constructed essentially as described for the Apep1 plasmid pTTv41 in Example 1, but an additional second selection marker cassette carrying hygromycin phosphotransferase gene (hph), was placed after the pyr4 gene creating a deletion plasmid with a double selection marker blaster cassette. The double marker system enables a) utilisation of e.g. hph as the initial resistance marker and faster selection; b) transformation of pyr4+ strains (without the need to generate pyr4- prior to transformation); and c) removal of both markers from the transformants using 5 fluoroorotic acid (like in removal of standard pyr4 blaster cassette) and simultaneous mutagenization of the endogenous pyr4 resulting in marker-free, pyr4- strain. In addition to the double marker, the first deletion plasmid contained also an overexpression cassette for native KEX2 (tre123561; promoter cDNA1, terminator cbh2). [00483] The second deletion plasmid for the aspartic protease pep2 (tre0053961), pTTv232, was constructed using the plasmid pTTv213 above as the backbone. The kex2 overexpression cassette (pcDNA1-kex2-tcbh2) was removed from pTTv213 with AscI digestion. Cloning of the plasmid pTTv232 was done with standard ligation (self-ligation) using T4 DNA ligase at room temperature. Part of the ligation mixture was transformed into E. coli with electroporation. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct ligation using standard laboratory methods. Correct ligation was further verified by sequencing. 163 WO 2013/102674 PCT/EP2013/050126 [00484] The third deletion plasmid for the aspartic proteasepep2 (tre0053961), pTTv246, was constructed using the plasmid pTTv232 above as the backbone. The pyr4-hph double marker was removed from pTTv232 with Nod digestion. The pyr4 marker gene was obtained from pTTv181 (Apep4-py4r above) with Nod digestion. Cloning of the plasmid pTTv246 was done with standard ligation using T4 DNA ligase at room temperature. Part of the ligation mixture was transformed into E. coli with electroporation. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct ligation using standard laboratory methods. Correct ligation and orientation of the marker was further verified by sequencing. [00485] 1000 bp of 5' flanking region and 1020 bp of 3' flanking region were selected as the basis of the pep2 deletion plasmids. A 300 bp stretch from the end of pep2 5' flank was used as the direct repeat fragment. These fragments as well as the second selection marker cassette (hph), cDNA1 promoter, native kex2 gene and cbh2 terminator were amplified by PCR using the primers listed in Table 14.1. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The pyr4 selection marker was obtained from pTTv181 (Apep4-pyr4 above) with NotI digestion. To enable removal of the complete double marker cassette in pTTv2l3, Nod restriction sites were introduced on both sides of the double marker cassette, and a Swal site between the two selection markers. AscI sites were introduced on both sides of the kex2 overexpression cassette (between pep2 5'direct repeat and 3' flank). Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid pTTv2l3 was constructed using the yeast homologous recombination method described in Example 1. These deletion plasmids for pep2 (pTTv2l3, pTTv232 and pTTv246, Table 14.1) result in a 1580 bp deletion in the pep2 locus and cover the complete coding sequence of PEP2. Table 14.1: Primers for generating pep2 deletion plasmids. Deletion plasmid pTTv213, vector backbone pRS426 Primer Sequence T43 1pep2-5flankF-pRS426 GATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGGTTT AAACCGGTTGTCCATTTCATCCTTC T629_pep2_5fjrev-pyr4 GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGGCG GCCGCGGGGAAGCAAGTTTCGAAGT T630_pep2_5DRfor-trpC GTACACTTGTTTAGAGGTAATCCTTCTTTCTAGAAGGAGAGCGG CCGCCTCCACGCTCTTGGCCAC 164 WO 2013/102674 PCT/EP2013/050126 T63 _pep2_5DR_rev_cDNA1 GTCATTAAGTCCATCATTCCACGTCCTTCAGACCGAATTCGGCGC GCCGGGGAAGCAAGTTTCGAAGT T632_pep2_3f_for_tcbh2 ATGATGCCTTTGCAGAAATGGCTTGCTCGCTGACTGATACGGCG CGCCTATCGCGAAAGTAGCCAATA T633_pep2_3f_rev AGCGGATAACAATTTCACACAGGAAACAGCGTTTAAACCATCCT TTTCCTCACCACGA T49 1_hph_recpyr4_for3 TGATTGTACCCCAGCTGCGATTGATGTGTATCTTTGCATGATTTA AATTCTCCTTAGCTCTGTACAGT T492_hph_rev2 GCGGCCGCTCTCCTTCTAGAAAGAAGGA T495_cDNA1_for GAATTCGGTCTGAAGGACGT T138_cDNA1_Rev GTTGAGAGAAGTTGTTGGATTG T139_123561ForcDNA1 AACCAAAGACTTTTTGATCAATCCAACAACTTCTCTCAACATGA AGATTTCCTCGATCCTTG T516_123561Rev TCAGCGCCGTAACCTCTGC T496_tcbh2_for TGATGGTGATGAGGCGGAAAAGCAGAGGTTACGGCGCTGAGGC TTTCGTGACCGGGCTTC T497_tcbh2_rev GTATCAGTCAGCGAGCAAGC Deletion plasmid pTTv232 Primer Sequence no new primers, pTTv213 digested with AscI (to remove kex2 overexpression cassette) and self-ligated Deletion plasmid pTTv246 Primer Sequence no new primers, pTTv232 digested with NotI and ligated with pyr4/NotI-fragment from pTTv181 Generation of 9-fold protease deletion strain with pep2 (tre53961); M574 [00486] To generate a marker-free 9-fold protease deletion strain, removal of the pyr4 marker was applied to the 8-fold deletion strain M504 (38-48A, pTTv229 in M496) essentially as described in Example 3 for removal of the pyr4 blaster cassette from the strain M195 (Apep1). Consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. [00487] Final clones were verified by PCR using the primers listed in Table 14.2 with standard laboratory methods. Signal corresponding to successful removal of the blaster cassette was obtained for majority of the clones. Removal of the blaster cassette was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. No growth was observed on the plates without uridine supplementation. Resulting strain used in generation of 9 fold protease deletion strain was designated with strain number M521. 165 WO 2013/102674 PCT/EP2013/050126 [00488] To remove vector sequence, plasmid pTTv246 (Apep2-pyr4) was digested with MssI and the correct fragment purified from an agarose gel using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the deletion cassette was used to transform a clone of 8-fold protease deletion strain M521 (ApeplAtsplAslpAgapAgap2Apep4Apep3Apep5, pyr4-). Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00489] Transformants were picked as first streaks. Growing streaks were screened by PCR (using the primers listed in Table 14.2) for correct integration. Clones giving the expected signals were purified to single cell clones and rescreened by PCR using the primers listed in Table 14.2. Deletion of pep2 was verified by Southern analyses from selected clones (data not shown) using methods described in Example 1. Clone 41-45G was designated with strain number M574. Table 14.2: Primers for screening removal of pyr4 blaster cassette from 8-fold protease deletion strain and for screening pTTv246/Apep2-pyr4 integration and strain purity. For screening removal of pyr4 blaster cassette from M504 and strain purity Primer Sequence T858_pep5_5f3 GGAATCGTCACCAAGGAG T755_pep5_3f rev3 CTTCTGGTGACATTCCGAC T627_pep5_5int new GTCGAAGATGTCCTCGAGAT T488_pyr45utr rev GGAGTTGCTTTAATGTCGGG T860_pep5orf3 GTCGAGCGTCTGATATTCAC T861_pep5orf r2 GACGGAGACCTCCCACA For screening integration of pTTv246 (Apep2-pyr4) Primer Sequence T596_pep2 fwd 5'flank screen CCTCTGCGTTGAGCAACATA T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA T061_pyr4orf screen 2F TTAGGCGACCTCTTTTTCCA T600_pep2 rev 3'flank screen CGAAAGCGTGGAGTCTTCTC For screening deletion of pep2 (tre53961) ORF T601_pep2 fwd GACGTGGTACGACAACATCG T623_pep2 rev TATCAAGGTACCGGGGACAG T1077_pep2orf-probef2 AACAAAGCCTTCACAGGCC T1078_pep2orfprober2 TGAGGCTCCTTCCAACTTTT 166 WO 2013/102674 PCT/EP2013/050126 Generation of 9-fold Protease Deletion Strain Having Deletions Apep1 Atsp1Aslp1 Agap1 Agap2Apep4Apep3Apep5Apep 12 Generation of pep]2 deletion plasmids [00490] The first deletion plasmid, pTTv209, for the aspartic protease pep12 (trel 19876) was constructed essentially as described for the Apep1 plasmid pTTv41 in Example 1, but an additional second selection marker cassette, a synthetic construct carrying a phosphinothricin N acetyltransferase gene (bar) of Streptomyces ssp., was placed after the pyr4 gene creating a deletion plasmid with a double selection marker blaster cassette. The double marker system enables a) utilisation of e.g. bar as the initial resistance marker and faster selection; b) transformation of pyr4+ strains (without the need to generate pyr4- prior to transformation); and c) removal of both markers from the transformants using 5-fluoroorotic acid (like in removal of standard pyr4 blaster cassette) and simultaneous mutagenization of the endogenous pyr4 resulting in marker-free, pyr4- strain. [00491] The second deletion plasmid for the aspartic protease pep12 (trel 19876), pTTv245, was constructed using the plasmid pTTv209 above as the backbone. The pyr4-bar double marker was removed from pTTv209 with NotI digestion. The new pyr4 marker gene was obtained from pTTv181 (Apep4-pyr4 above) with NotI digestion. Cloning of the plasmid pTTv245 was done with standard ligation using T4 DNA ligase at room temperature. Part of the ligation mixture was transformed into E. coli with electroporation. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct ligation using standard laboratory methods. Correct ligation and orientation of the marker was further verified by sequencing. [00492] 1019 bp of 5' flanking region and 895 bp of 3' flanking region were selected as the basis of the pep12 deletion plasmids. A 300 bp stretch from the end of pep12 5' flank was used as the direct repeat fragment. These fragments were amplified by PCR using the primers listed in Table 14.3. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The double marker (pyr4-bar) was digested from pTTv202 (Apep5-pyr4-bar) with 167 WO 2013/102674 PCT/EP2013/050126 NotI. To enable removal of the complete double marker cassette, NotI restriction sites were introduced on both sides of the double marker cassette. AscI site was introduced between the pep12 5'direct repeat and 3' flank. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid pTTv209 was constructed using the yeast homologous recombination method described in Example 1. These deletion plasmids for pep] 2 (pTTv209 and pTTv245, Table 14.3) result in a 2198 bp deletion in the pep12 locus and cover the complete coding sequence of PEP12. Table 14.3: Primers for generating pep12 deletion plasmids. Deletion plasmid pTTv209 (Apep12-pyr4-bar), vector backbone pRS426 Primer Sequence T477_pep12_5f_for GGTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAAC CGACAGCACGTTGTGTGCTCC T478_pep12_5f_rev GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTA GGCGGCCGCTGGAGACCCAGCAGCCAGCA T479_pep12_DRfor CCCGTCACCGAGATCTGATCCGTCACCGGGATCCACTTAA GCGGCCGCTCAGAGGGAGGCTGCCCAAC T480_pepl2_DRrev GAGACTCGAACAAAGACATCTTTGCGACCTCGTCCAC GGCGGCGCGCCTGGAGACCCAGCAGCCAGCA T481_pep12_3f for GCCGTGGACGAGGTCGCAAA T482_pep2_3frev AGCGGATAACAATTTCACACAGGAAACAGCGTTTAAAC CCCTGCGCCCTCTTCTGCAC Deletion plasmid pTTv245 (Apep12-pyr4) Primer Sequence no new primers, pTTv209 digested with NotI and ligated with pyr4 fragment from pTTv181 Generation of 9-fold protease deletion strain with pep12 (tre]19876); M575 [00493] To generate a marker-free 9-fold protease deletion strain, removal of the pyr4 marker was applied to the 8-fold deletion strain M504 (38-48A, pTTv229 in M496) essentially as described in Example 3 for removal of the pyr4 blaster cassette from the strain M195 (Apep1). Consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. [00494] Final clones were verified by PCR using the primers listed in Table 14.4 with standard laboratory methods. Signal corresponding to successful removal of the blaster cassette was 168 WO 2013/102674 PCT/EP2013/050126 obtained for majority of the clones. Removal of the blaster cassette was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. No growth was observed on the plates without uridine supplementation. Resulting strain used in generation of 9 fold protease deletion strain was designated with strain number M521. [00495] To remove vector sequence, plasmid pTTv245 (Apep12-pyr4) was digested with MssI and the correct fragment purified from an agarose gel using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the deletion cassette was used to transform a clone of 8-fold protease deletion strain M521 (Apepl Atspl Aslpl Agapl Agap2Apep4Apep3Apep5, pyr4-). Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00496] Transformants were picked as first streaks. Growing streaks were screened by PCR (using the primers listed in Table 14.4) for correct integration. Clones giving the expected signals were purified to single cell clones and rescreened by PCR using the primers listed in Table 14.4. Deletion of pep12 was verified by Southern analyses from selected clones (Data not shown) using methods described in Example 1. Clone 42-45B was designated with strain number M575. Table 14.4: Primers for screening removal of pyr4 blaster cassette from 8-fold protease deletion strain and for screening pTTv245/Apep12-pyr4 integration and strain purity. For screening removal of pyr4 blaster cassette from M504 and strain purity Primer Sequence T858_pep5_5f f3 GGAATCGTCACCAAGGAG T755_pep5_3f rev3 CTTCTGGTGACATTCCGAC T627_pep5_5int new GTCGAAGATGTCCTCGAGAT T488_pyr45utr rev GGAGTTGCTTTAATGTCGGG T860_pep5orf3 GTCGAGCGTCTGATATTCAC T861_pep5orf r2 GACGGAGACCTCCCACA For screening integration of pTTv245 (Apep12-pyr4) Primer Sequence T517_pep12_5int AGCAGTCCACCTGCTCAAAA T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA T061_pyr4orfscreen_2F TTAGGCGACCTCTTTTTCCA T518_pep12 3int GATTCACACCAATGAGTCGG For screening deletion of pep12 (trel 19876) ORF 169 WO 2013/102674 PCT/EP2013/050126 T486_pepl2orfprobef CCCCGACTTTGCCCCGTCAC T487_pepl2orfprober TCGTCAGAGTCGTCGCCCGT T1057_pepl2orfprobef2 GCGCAGCTAATGTCCTCTGT T1058_pep12orfprober2 TTGTTGAGCCAGAGTCGAGA Example 15 - Generation of 10-fold protease deletion strain Generation of 10-fold Protease Deletion Strain Having Deletions Apep]Atsp]Aslp] Agap] Agap2Apep4Apep3Apep5Apep2Apep1] Generation of pep] 1 deletion plasmid [00497] The deletion plasmid pTTv3l2 for the aspartic protease pep]] (tre121306) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. [00498] 956 bp of 5' flanking region and 943 bp of 3' flanking region were selected as the basis of the pep]1 deletion plasmid. A 307 bp stretch from the end of pep]1 5' flank was used as the direct repeat fragment. These fragments were amplified by PCR using the primers listed in Table 15.1. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The pyr4 cassette was obtained from pTTv181 (Apep4-pyr4 above) with NotI digestion. To enable removal of the marker cassette, NotI restriction sites were introduced on both sides of the cassette. AscI site was introduced between the pep]1 5'direct repeat and 3' flank. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for pep]1 (pTTv3 12, Table 15.1) results in 2624 bp deletion in the pep]1 locus and covers the complete coding sequence of PEP11. Table 15.1: Primers for generating pepl deletion plasmids. Deletion plasmid pTTv3l2 (Apepll-pyr4), vector backbone pRS426 Primer Sequence T1009_pep 115flkfw vector GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAAC ATGAGCGTGATCGACAAGTG 170 WO 2013/102674 PCT/EP2013/050126 Ti01_pep11_5flkrevpyr4Prom GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAG GCGGCCGCCCTCTGAGGTCGAGATGGAG TI 144_pep11_5drfor TGATTGTACCCCAGCTGCGATTGATGTGTATCTTTGCAT GGCGGCCGCACGACTAATATCCACTGCCG TI 145_pep11_5drrev AACCAAAGTGTACAATGCTCATCTCGTATTCACATGCAAA GGCGCGCCCCTCTGAGGTCGAGATGGAG T1146_pep11 3f for TTTGCATGTGAATACGAGATGA T1012_pepI_3flkrevvector GCGGATAACAATTTCACACAGGAAACAGCGTTTAAAC TGCTCGATCCTACTCCAAGG Generation of 10-fold protease deletion strain with pep1] (tre121306); M658 [00499] To generate a marker-free 10-fold protease deletion strain, removal of the pyr4 marker was applied to the 9-fold deletion strain M574 (41-45G, pTTv246 in M521) essentially as described in Example 3 for removal of the pyr4 blaster cassette from the strain M195 (Apep1). Consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. [00500] Final clones were verified by PCR using the primers listed in Table 15.2 with standard laboratory methods. Signal corresponding to successful removal of the blaster cassette was obtained for majority of the clones. Removal of the blaster cassette was further verified by plating the clones onto minimal medium plates with or without 5 mM uridine. No growth was observed on the plates without uridine supplementation. Resulting strain used in generation of 10-fold protease deletion strain was designated with strain number M597. [00501] To remove vector sequence, plasmid pTTv3l2 (Apep11-pyr4) was digested with MssI and the correct fragment purified from an agarose gel using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the deletion cassette was used to transform a clone of 9-fold protease deletion strain M597 (ApeplAtspl Aslpl AgaplAgap2Apep4Apep3Apep5Apep2, pyr4-). Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00502] Transformants were picked as first streaks. Growing streaks were screened by PCR (using the primers listed in Table 15.2) for correct integration. Clones giving the expected signals 171 WO 2013/102674 PCT/EP2013/050126 were purified to single cell clones and rescreened by PCR using the primers listed in Table 15.2. Deletion of pep]1 was verified by Southern analyses from selected clones (data not shown) using methods described in Example 1. Clone 47-62B was designated with strain number M632. An additional single cell purification step was applied to strain M632 to obtain 10-fold protease deletion strain M658. Table 15.2: Primers for screening removal of pyr4 blaster cassette from 9-fold protease deletion strain and for screening pTTv312/Apep11-pyr4 integration and strain purity. For screening removal of pyr4 blaster cassette from M574 and strain purity Primer Sequence TI 162_pep2_5f f2 CTGTAAAGGCAGCATCGG TI 163_pep2_3f r2 TCAGAACGGCTTCAATCATT TI 162_pep2_5f f2 CTGTAAAGGCAGCATCGG T488_pyr45utr rev GGAGTTGCTTTAATGTCGGG T601_pep2 fwd GACGTGGTACGACAACATCG T623_pep2 rev TATCAAGGTACCGGGGACAG For screening integration of pTTv3l2 (Apepll-pyr4) Primer Sequence T1013_pepllscreen 5flk fwd TTACGACTCGATCCCTGTCC T488_pyr45utr rev GGAGTTGCTTTAATGTCGGG T061_pyr4orf screen 2F TTAGGCGACCTCTTTTTCCA T1016_pep11 screen 3flk rev GCCGCTAGGATCGTGATAAG For screening deletion of pep1I ORF T1017_pep1l orf fwd GTGTCCCAGGACGACAACTT T1018_pep1l orf rev TGAAGGTTGCAGTGATCTCG Example 16 - GENERATION OF TPP1 DELETION PLASMID [00503] The deletion plasmid pTTv331 for tripeptidyl peptidase tpp] (tre82623) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1, except that the marker used for selection was a double marker pyr4-hph. [00504] 1245 bp of 5' flanking region and 1025 bp of 3' flanking region were selected as the basis of the tpp1 deletion plasmid. A 311 bp stretch from the end of tpp1 5' flank was used as the direct repeat fragment. These fragments were amplified by PCR using the primers listed in Table 172 WO 2013/102674 PCT/EP2013/050126 16.1. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The pyr4-hph cassette was obtained from pTTv210 (Asep1-pyr4-hph) with Nod digestion. To enable removal of the complete double marker cassette, Nod restriction sites were introduced on both sides of the double marker cassette. AscI site was introduced between the tpp1 5'direct repeat and 3' flank. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed using the yeast homologous recombination method described in Example 1. This deletion plasmid for tpp1 (pTTv331, Table 16.1) results in 2152 bp deletion in the tpp1 locus and covers the complete coding sequence of TPP1. Table 16.1: Primers for generating tpp1 deletion plasmid. Deletion plasmid pTTv331 (Atppl-pyr4-hph), vector backbone pRS426 Primer Sequence T311_82623_5for GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAAC CGCATTACGAATGCACAAAG TI 190_tppl5frev2 GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTA GGCGGCCGCCCATGTCAGCTCAGACCAAT TI 19 1tppl5drjfor GTACACTTGTTTAGAGGTAATCCTTCTTTCTAGAAGGAGA GCGGCCGCAGGCCCTGGACTGCTAGTTT TI 192_tppl5drjrev CGAGCCATCCGCCGCGGCCCTATATTCCACCCGAGTCCT CGGCGCGCCCCATGTCAGCTCAGACCAAT T1193_tppl3f for2 GAGGACTCGGGTGGAATATAGG T314_82623_3rev GCGGATAACAATTTCACACAGGAAACAGCGTTTAAAC TTGGTCTTGAATGAAAGGTGTG Example 17 - GENERATION OF PEP8 DELETION PLASMIDS [00505] Another deletion plasmid pTTv3l9 for aspartic protease pep8 (tre122076) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1. [00506] The second deletion plasmid for the aspartic protease pep8 (tre122076), pTTv328, was constructed using the plasmid pTTv319 above as the backbone. The pyr4 marker was removed from pTTv3l9 with Nod digestion. The pyr4-hph cassette was obtained from pTTv210 (Asepl-pyr4-hph) with Nod digestion. Cloning of the plasmid pTTv328 was done with standard ligation using T4 DNA ligase at room temperature. Part of the ligation mixture was transformed 173 WO 2013/102674 PCT/EP2013/050126 into E. coli with electroporation. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct ligation using standard laboratory methods. Correct ligation and orientation of the marker was further verified by sequencing. [00507] 1095 bp of 5' flanking region and 988 bp of 3' flanking region were selected as the basis of the pep8 deletion plasmids. A 324 bp stretch from the end of pep8 5' flank was used as the direct repeat fragment. These fragments were amplified by PCR using the primers listed in Table 17.1. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The pyr4 selection marker used in pTTv319 was obtained from pTTv 181 (Apep4-pyr4 above) with Nod digestion. To enable removal of the pyr4 marker cassette, NotI restriction sites were introduced on both sides of the cassette. AscI site was introduced between the pep8 5'direct repeat and 3' flank. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid pTTv319 was constructed using the yeast homologous recombination method described in Example 1.These deletion plasmids for pep8 (pTTv3l9 and pTTv328, Table 17.1) result in a 1543 bp deletion in the pep8 locus and cover the complete coding sequence of PEP8. Table 17.1: Primers for generating pep8 deletion plasmid. Deletion plasmid pTTv3l9 (Apep&pyr4), vector backbone pRS426 Primer Sequence T1019_pep8_5flkfw vector GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAAC AGGTTTGGGTTGTGAGATCG T1020_pep8_5flkrev-pyr4Prom GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTA GGCGGCCGCGCGCAAAGCTACTGGGCTAT TI 167_pep8_5DRjfor TGATTGTACCCCAGCTGCGATTGATGTGTATCTTTGCAT GGCGGCCGCTCTGCTCTGCTCTGTTCTGC TI 168_pep8_5DRjrev AAAGTTCGTCAAAGAGCACTCATAGGGCTGAGAAAA GCCAGGCGCGCCGCGCAAAGCTACTGGGCTAT T1169_pep8_3f for2 TGGCTTTTCTCAGCCCTATG T1022pep8_3flkrev vector GCGGATAACAATTTCACACAGGAAACAGCGTTTAAAC CAATGTGTGCCTGTTTTTCG Deletion plasmid pTTv328 (Apep8-pyr4-hph) Primer Sequence no new primers, pTTv319 digested with NotI and ligated with pyr4-hph fragment from pTTv210 174 WO 2013/102674 PCT/EP2013/050126 [00508] The third deletion plasmid pTTv266 for aspartic protease pep8 (tre122076) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1, except that the marker used for selection was pyr4-hgh from pTTv 194. [00509] 1095 bp of 5' flanking region and 988 bp of 3' flanking region were selected as the basis of the pep8 deletion plasmid pTTv266. These fragments were amplified by PCR using the primers listed in Table 17.2. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The pyr4-hgh selection marker used in pTTv266 was obtained from pTTv194 (Apep4-pyr-hgh above) with Nod digestion. To enable removal of the pyr4-hgh marker cassette, Nod restriction sites were introduced on both sides of the cassette. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid pTTv266 was constructed with the 5' flank, 3' flank, pyr4-hgh marker, and vector backbone using the yeast homologous recombination method described in Example 1.The deletion plasmids for pep8 (pTTv266, Table 17.2) result in a 1543 bp deletion in the pep8 locus and cover the complete coding sequence of PEP8. Table 17.2: Primers for generating pep8 deletion plasmid. Deletion plasmid pTTv266 (Apep8-pyr4-hgh), vector backbone pRS426 Primer Sequence T1019_pep8_5flkfw-vector GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAACAGGTTT GGGTTGTGAGATCG T1020_pep8_5flkrev-pyr4Prom GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAGG CGGCCGCGCGCAAAGCTACTGGGCTAT T1021_pep8_3flkfw-pyr4oop CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGC GGCCGCTGGCTTTTCTCAGCCCTATG T1022_pep8_3flkrev vector GCGGATAACAATTTCACACAGGAAACAGCGTTTAAACCAATG TGTGCCTGTTTTTCG Example 18 - GENERATION OF PROTEASE DELETIONS IN THE INTERFERON PRODUCING STRAINS Generation of IFN-a 2b Producin2 5-fold Protease Deletion Strain 175 WO 2013/102674 PCT/EP2013/050126 [00510] To generate the IFN-a 2b producing strain for the five fold protease deletion strain, the Apep1ztsp1Aslp1Agap1Agap2 five fold protease deletion strain M369 was transformed with IFN-a 2b expression cassette (pTTvl73) using hygromycin in selection. This IFN-a 2b strain with Apep1ztsp1Aslp1Agap1Agap2 five fold protease deletions was designated with number M401. Analysis of IFN-a 2b producing 5-Fold Protease Deletion Strain M401 [00511] To study the expression level of IFN-a 2b, the 5-fold protease deletion (Apep1Atsp1Aslp1Agap1Agap2) IFN-a 2b producing strain M401 was cultured in culture conditions pH 4,5; 28->22'C; 30 g/l glucose, 60 g/l lactose, 20 g/l whole spent grain, and 20 g/l spent grain extract. To analyze the expression level of IFN-a 2b, day 3 culture sample was subjected to quantitative immunoblotting (Fig. 54A). The samples were analysed by comparison to IFN-a 2b standard curve and the densitometric quantification was done with Totallab Quant TL100 software. Immunoblotting was done with Abcam (#ab9386) anti-IFN-a 2b antibody diluted to 1 pg/ml in TBST. The secondary antibody from Bio-rad (#170-6520) goat anti-mouse IgG AP conjugated secondary antibody diluted 1:5000 in TBST. The protein standards were loaded to the gel corresponding 50 ng, 100 ng, 200 ng and 400 ng of IFN-a 2b. The analysis showed that M401 produced IFN-a 2b at yields of up to 51.9 mg/l and 52% of the product was cleaved from the carrier molecule. Generation of IFN-a 2b producing 8-fold protease deletion strain M577 [00512] To generate the IFN-a 2b producing strain for the eight fold protease deletion strain, the ApeplAtsplAslpAgapAgap2Apep4Apep3Apep5 eight fold protease deletion strain M504 was transformed with IFN-a 2b expression cassette (pTTv254) using acetamide in selection. This IFN-a 2b strain with Apep1AtsplAslpAgapAgap2Apep4Apep3Apep5 eight fold protease deletions was designated with number M577. Analysis of IFN-a 2b producing 8-Fold Protease Deletion Strain M577 176 WO 2013/102674 PCT/EP2013/050126 [00513] To study the expression level of IFN-a 2b, the 8-fold protease deletion (ApeplAtsplAslplAgapAgap2Apep4Apep3Apep5) IFN-a 2b producing strain M577 was cultured in the conditions pH 4,5; 28->22'C; 2% yeast extract, 4% cellulose, 8% cellobiose and 4% sorbose. To study the expression of IFN-a 2b, M577 fermentation samples were subjected to immunoblotting (Fig. 54B). To analyse the expression level of IFN-a 2b, day 4 culture sample was subjected to quantitative immunoblotting (Fig. 55). The sample was analysed by comparison to IFN-a 2b standard curve and the densitometric quantification was done with Totallab Quant TL100 software. Immunoblotting was done with Abcam (#ab9386) anti-IFN-a 2b antibody diluted to 1 pg/ml in TBST. The secondary antibody from Bio-rad (#170-6520) goat anti-mouse IgG AP conjugated secondary antibody diluted 1:5000 in TBST. The protein standards were loaded to the gel corresponding 50 ng, 100 ng and 200 ng of IFN-a 2b. The analysis showed that M577 produced IFN-a 2b at yields of up to 1780 mg/l and 66.5% of the product was cleaved from the carrier molecule. The 8-fold protease deletion strain M577 produced 34 times more IFN-a 2b than 5-fold protease deletion strain M401. Generation of IFN-a 2b producing 9-fold Protease Deletion Strain M652 [00514] To generate the IFN-a 2b producing strain for the nine fold protease deletion strain, the ApeplAtsplAslpAgapAgap2Apep4Apep3Apep5Apep2 nine fold protease deletion strain M574 was transformed with IFN-a 2b expression cassette (pTTv173) using hygromycin in selection. This IFN-a 2b strain with ApeplAtsplAslpAgapAgap2Apep4Apep3Apep5Apep2 nine fold protease deletions was designated with number M652. Analysis of IFN-a 2b producing 9-Fold Protease Deletion Strain M652 [00515] To study the expression level of IFN-a 2b, the 8-fold protease deletion (ApeplAtsplAslpAgapAgap2Apep4Apep3Apep5Apep2) IFN-a 2b producing strain M652 was cultured in the conditions pH 4,5; 28->22'C; 2% yeast extract, 4% cellulose, 8% cellobiose and 4% sorbose. To study the expression of IFN-a 2b, M652 fermentation samples were subjected to immunoblotting (Fig. 54B). To analyse the expression level of IFN-a 2b, day 3 culture sample was subjected to quantitative immunoblotting (Fig. 55). The sample was analysed by comparison 177 WO 2013/102674 PCT/EP2013/050126 to IFN-a 2b standard curve and the densitometric quantification was done with Totallab Quant TL100 software. Immunoblotting was done with Abcam (#ab9386) anti-IFN-a 2b antibody diluted to 1 pg/ml in TBST. The secondary antibody from Bio-rad (#170-6520) goat anti-mouse IgG AP conjugated secondary antibody diluted 1:5000 in TBST. The protein standards were loaded on the gel corresponding 50 ng, 100 ng and 200 ng of IFN-a 2b. The analysis showed that M652 produced IFN-a 2b at yields of up to 1928 mg/l and 85% of the product was cleaved from the carrier molecule. The 9-fold protease deletion strain M652 produced slightly more than 8-fold protease deletion M577 and 37 times more IFN-a 2b than 5-fold protease deletion strain M401. Generation of 9-fold protease deletion strain M670 with pep8 (trel22076) deleted from the interferon production strain M577 [00516] To remove the deletion cassette, plasmid pTTv266 (Apep8-pyr4-hgh) was digested with PmeI and the correct fragment was purified using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the deletion cassette was used to transform the 8-fold protease deletion strain M577 (Apep1Atsp1Aslp1Agap1Agap2Apep4Apep3Apep5). The M577 strain produces interferon alpha 2b. Preparation of protoplasts and transformation were carried out essentially as described in Example 1 using hygromycin selection. [00517] Transformants were picked and streaked on selection plates. Growing streaks were screened by PCR (using the primers listed in Table 18.1) for correct integration. Clones giving the expected signals were purified to single cell clones and rescreened by PCR using the primers listed in Table 18.1. Clone 82-9 was designated with strain number M670. Table 18.1: Primers for screening pTTv266/Apep8-pyr4-hgh integration and strain purity. For screening integration of pTTv266 (Apep8-pyr4-hgh) Primer Sequence T1023_pep8_screen_5flk fwd TTTATCCGCTTCCACGACAC T1084_screen_5flk-pyrjrev TCTTGAGCACGACAATCGAC T1015_screen_3flkhygrojfwd GCATGGTTGCCTAGTGAATG T1024 pep8_screen_3flk_rev CGATGGTGAAGTCAATGTGG For screening deletion of pep8 ORF T1025_pep8_orf fwd GGCGATTACTTCCAGGACAA T1026_pep8_orf rev CAATGGCAATCTGGTTGTTG 178 WO 2013/102674 PCT/EP2013/050126 Generation of pep] 1 deletion plasmid [00518] The deletion plasmid pTTv268 for the aspartic protease pep]] (tre121306) was constructed essentially as described for pep] deletion plasmid pTTv41 in Example 1, except that the marker used for selection was pyr4-hgh from pTTv 194. [00519] 956 bp of 5' flanking region and 957 bp of 3' flanking region were selected as the basis of the pep]1 deletion plasmid pTTv268. These fragments were amplified by PCR using the primers listed in Table 18.2. The products were separated with agarose gel electrophoresis and the correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods. The pyr4-hgh cassette was obtained from pTTv 194 (Apep4-pyr-hgh) with NotI digestion. To enable removal of the marker cassette, NotI restriction sites were introduced on both sides of the cassette. Vector backbone was EcoRI/XhoI digested pRS426 as in Example 1. The plasmid was constructed. The plasmid pTTv268 was constructed with the 5' flank, 3' flank, pyr4-hgh marker, and vector backbone using the yeast homologous recombination method described in Example 1. This deletion plasmid for pep]1 (pTTv268, Table 18.2) results in a deletion in the pep]] locus and covers the complete coding sequence of PEPI 1. Table 18.2: Primers for generating pepl deletion plasmids. Deletion plasmid pTTv268 (Apep1l-pyr4-hgh), vector backbone pRS426 Primer Sequence T1009_pep 115flkfwvector GTAACGCCAGGGTTTTCCCAGTCACGACGGTTTAAAC ATGAGCGTGATCGACAAGTG T101 Opep 1_5flkrevpyr4Prom GCGCTGGCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAG GCGGCCGCCCTCTGAGGTCGAGATGGAG T10 11 pep 113flkfw-pyr4loop CAACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGCGG CCGCTTTGCATGTGAATACGAGATGA T1012_pep 113flkrevvector GCGGATAACAATTTCACACAGGAAACAGCGTTTAAAC TGCTCGATCCTACTCCAAGG Generation of 9-fold protease deletion strain M672 with pep]] (tre]21306) deleted from the interferon production strain M577 179 WO 2013/102674 PCT/EP2013/050126 [00520] To remove the deletion cassette, plasmid pTTv268 (Apep1l-pyr4-hgh) was digested with PmeI and the correct fragment was purified using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the deletion cassette was used to transform the 8-fold protease deletion strain M577 (Apep1Atsp1Aslp1Agap1Agap2Apep4Apep3Apep5). The M577 strain produces interferon alpha 2b. Preparation of protoplasts and transformation were carried out essentially as described in Example 1 using hygromycin selection. [00521] Transformants were picked and streaked on selection plates. Growing streaks were screened by PCR (using the primers listed in Table 18.3) for correct integration. Clones giving the expected signals were purified to single cell clones and rescreened by PCR using the primers listed in Table 18.3. Clone 33-9 was designated with strain number M672. Table 18.3: Primers for screening pTTv268/Apep11-pyr4-hgh integration and strain purity. For screening integration of pTTv268 (Apep1l-pyr4-hgh) Primer Sequence T1013_pepl 1screen_5flk_fwd TTACGACTCGATCCCTGTCC T1084_screen_5flk pyrrev TCTTGAGCACGACAATCGAC T1015_screen_3flkjhygrojfwd GCATGGTTGCCTAGTGAATG T1016_pepllscreen_3flk_rev GCCGCTAGGATCGTGATAAG For screening deletion of pep1I ORF T1017_pepllorfjfwd GTGTCCCAGGACGACAACTT T1018_pepl1orfjrev TGAAGGTTGCAGTGATCTCG Generation of 9-fold protease deletion strain M673 with sip7 (tre123865) deleted from the interferon production strain M577 [00522] To remove the deletion cassette, plasmid pTTv269 (Aslp7-pyr4-hgh) was digested with PmeI and the correct fragment was purified using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the deletion cassette was used to transform the 8-fold protease deletion strain M577 (Apep1Atsp1Aslp1Agap1Agap2Apep4Apep3Apep5). The M577 strain produces interferon alpha 2b. Preparation of protoplasts and transformation were carried out essentially as described in Example 1 using hygromycin selection. 180 WO 2013/102674 PCT/EP2013/050126 [00523] Transformants were picked and streaked on selection plates. Growing streaks were screened by PCR (using the primers listed in Table 18.4) for correct integration. Clones giving the expected signals were purified to single cell clones and rescreened by PCR using the primers listed in Table 18.4. Clone 5-64 was designated with strain number M673. Table 18.4: Primers for screening pTTv269/Aslp7-pyr4-hgh integration and strain purity. For screening integration of pTTv269 (Aslp7-pyr4-hgh) Primer Sequence T1092_slp7screen_5flk_fwd TTGGTTTGAACAGCTGCAAG T1084_screen_5flk pyrrev TCTTGAGCACGACAATCGAC T1015_screen_3flkjhygrojfwd GCATGGTTGCCTAGTGAATG T1093_slp7screen_3flk_rev ATGGTCAGCCAGAACCTGAC For screening deletion of slp7 ORF T1094_slp7orf fwd TCTTGAGCCGTTTCTCGAAT T1095_slp7orf rev CCGCTCTTAGATCGATGGTC Example 19 - GENERATION OF GO PRODUCING STRAINS M627 AND M629 [00524] Vectors pTTg156 and pTTg173 were constructed by adding the double selection marker cassette (Hygromycin resistance marker gene (hph) between pkil promoter and cbh2 terminator in addition to pyr4 expression cassette) to intermediate vectors pTTg 145 and pTTgl46. Intermediates were constructed by yeast recombination cloning, marker cassettes were added by conventional cloning by NotI digestion and ligation. [00525] The generation strategy of fragments for intermediate vectors is presented on Table 19.1 below. Primers used for fragment generation are listed on Table 19.2 below. Once the fragments for pTTg145 and pTTg146 were constructed according to plan on Table 19.1, they were electroporated to yeast Saccharomyces cerevisiae FY834 for plasmid assembly by homologous recombination. Yeast cells were plated to SC-ura for 2-3 days cultivation in +30'C. Colonies were then pooled from the plates and plasmid pool was purified with Phenol/Chloroform extraction method. Plasmid pool was transformed to competent E. coli cells by electroporation. Electroporated cells were plated to LB+amp selection plates, cultivated 181 WO 2013/102674 PCT/EP2013/050126 +37'C over night and colonies were screened by PCR. Positive colonies were then streaked to fresh plates as pure cultures, single colonies were cultured in liquid LB+amp media and potential intermediate vectors pTTgl45 and pTTgl46 were purified according to standard protocols. Plasmids were analyzed by restriction analysis and sequences were verified by sequencing. [00526] Marker cassette was then added to vectors by conventional NotI digestion from pTTgl63 and ligation into NotI linearized intermediates pTTgl45 and pTTg146. Table 19.1: Construction strategy of intermediate vectors pTTgl45-pTTgl49. The pTTv141 and pTTv11 are described in International Patent Application No. PCT/EP2011/070956. The plasmids pTTg124 and pTTv225 were used for construction of fragments specified in table below. Vector code Fragment 1 Fragment 2 Fragment 3 Fragment 4 pTTgl45 (intermediate pTTvl41 cut with PCR product from pTTv 11 cut with PCR product from for pTTgl56) NotI pTTgl24 template SacII/NdeI pTTv 11 template GP364, GP334 GP342, GP358 >pCDNA promoter sequence and overlap to GnTI pTTgl46 (intermediate pTTvl41 cut with PCR product from PCR product from n/a for pTTgl73) NotI pTTv225 template pTTv 11 template GP395, GP334 GP340, GP336 >pCDNA promoter sequence with Kre2 leader and overlap to GnTI Table 19.2: Primers used for construction of intermediate vectors pTT145-pTTgl49. Code Sequence 5' > 3' GP364 TCTCCACTCGACCTGCAGGCATGCGCGATCGCGCGGCCGAATTCGGTCTGAAGGACGTGG GP334 TGGCGCCCCACAGCACAAGCCCTGCAGACTGCTTCTTCAGCATGTTGAGAGAAGTTGTTGG GP395 CATCTCCACTCGACCTGCAGGCATGCGCGATCGCGCGGCCGAATTCGGTCTGAAGGACGTGG GP340 GGGGATGCCCTGTCGAGCCAGCGGGGGAGGGTGCCCACCGCCGCCCCTCCCGCCCAGCCG GP336 GAAGGTGGTTTTTGCCTGTATAAGCCAGCCATCCGGCATACTGCCCGCGGCCGCCCTGCAGTGCAG GATCTGC GP342 TGGCGCCCCCACCGACGTGGGAGGGCTATGATCCCAGCTGGAATTAGCATATGATTAATTAAGG GP358 GGTTTTTGCCTGTATAAGCCAGCCATCCGGCATACTGCCCGCGGCCGCAGTGCAGGATCTGC 182 WO 2013/102674 PCT/EP2013/050126 [00527] Trichoderma reesei MABO expression strain M507 with 7-fold protease deletion was transformed with the PmeI fragments of pTTgl56 and pTTgl73 targeted to alg3 locus. Variable amount of transformants (100-170 depending on the construct) were picked onto selective plates. On the basis of PCR screening with Phire Plant Direct PCR kit (Finnzymes F-130), clones with positive results concerning 5'- and 3'-integration were selected for single spore platings and re screening for integration and alg3 deletion (5 clones from pTTgl56 trasformation, 3 clones from pTTgl73 transformation). Primers used for screening are listed on Table 19.3 below. [00528] PCR-screened strains were finally subjected to shake flask cultivation and glycan analysis. Final strains were named as M629 (pTTgl73 transformant) and M627 (pTTgl56 transformant). Table 19.3: Primers used for screening alg3 integration in M507 pTTg156 and pTTg173. Code Description Sequence 5' - 3' GP488 alg3 5' integration screen GATGTTGCGCCTGGGTTGAC Forward outside the flank GP495 alg3 5' integration screen CTTCTTATTGATTTGAGCC Reverse from pGPDA GP490 alg3 3' integration screen GATTGTCATGGTGTACGTGA Reverse outside the flank GP497 alg3 3' integration screen GAGCCGCATCGCATAG Forward from cbhII terminator GP491 alg3 orf, forward (1492 bp product) GCGTCACTCATCAAAACTGC GP492 alg3 orf, reverse (1492 bp product) CTTCGGCTTCGATGTTTCA WSG Fermentation of Strains M627 and M629 and Glycan Analysis [00529] T. reesei strains M627 and M629 were fermented in 4% WSG, 2% glucose, 4% cellobiose, 6% lactose, pH 5.5, and sampling was performed at days 3-6. The antibody titers are shown in Table 19.4. [00530] For N-glycan analysis MABO1 was purified from culture supernatants using Protein G HP MultiTrap 96-well filter plate (GE Healthcare) according to manufacturer's instructions. The antibody concentrations were determined via UV absorbance against MABO standard curve. 183 WO 2013/102674 PCT/EP2013/050126 [00531] N-glycans were released from EtOH precipitated and SDS denatured antibody using PNGase F (ProZyme Inc.) in 20 mM sodium phosphate buffer, pH 7.3, in overnight reaction at +37 0 C. The released N-glycans were purified with Hypersep C-18 and Hypersep Hypercarb (Thermo Scientific) and analysed with MALDI-TOF MS. The results are shown in Table 19.6. In the strains M627 and M629 GO levels ranged between 24.3% to 41.7%, no GO was seen in the strain M507. WSG Cultivation in Shake Flasks of Strains M627 and M629 and Glycan Analysis [00532] T. reesei strains M627 and M629 were cultivated in shake flasks in TrMM, 4% lactose, 2% SGE, 100 mM PIPPS, pH 5.5, at +28'C. Sampling was performed at day 5. [00533] For N-glycan analysis MABO1 was purified from culture supernatants using Protein G HP MultiTrap 96-well filter plate (GE Healthcare) according to manufacturer's instructions. The antibody concentrations in Protein G eluents were determined via UV absorbance against MABO standard curve (Table 19.5). Titers in culture medium were not measured. [00534] N-glycan release was performed as above, the results are shown in Table 19.7. GO levels were 21.1 and 56.9 % for M627 and M629, respectively. Table 19.4: Antibody titers in fermentation culture supernatants of strains M627 and M629 fermented in WSG medium. Strain Titer (g/l) day3 day4 day5 day6 M627 0.294 0.580 0.813 0.818 M629 0.292 0.538 0.755 0.821 Table 19.5: Antibody concentrations in Protein G eluents of strains M627 and M629 cultivated in WSG medium in shake flasks. Titer (g/i) Strain in Prot G eluent day 5 M507 0.303 M627 0.105 M629 0.103 184 WO 2013/102674 PCT/EP2013/050126 Table 19.6: Relative proportions of neutral N-glycans from purified antibody from strains M627 and M629 fermented in WSG medium. Sampling at days 3-6. M627 M629 d3 d4 dS d6 d3 d4 dS d6 Composition Short mz % % % % % % % % Hex3HexNAc2 Man3 933.31 3.7 7.9 10.6 11.5 2.6 6.6 11.5 12.2 Hex4HexNAc2 Man4 1095.37 2.1 1.9 2.2 1.9 1.6 1.8 2.1 2.2 Hex3HexNAc3 GnMan3 1136.40 0.0 0.3 0.1 0.0 0.0 0.2 0.4 0.1 Hex5HexNAc2 Man5 1257.42 1.4 1.7 1.3 1.4 1.5 1.3 1.3 1.0 Hex3HexNAc4 GO 1339.48 31.7 32.6 28.3 25.0 41.7 40.0 42.9 24.3 Hex6HexNAc2 Hex6 1419.48 60.0 55.5 57.2 60.0 51.6 49.9 41.3 59.8 Hex7HexNAc2 Hex7 1581.53 1.1 0.3 0.3 0.2 0.9 0.3 0.4 0.4 Hex8HexNAc2 Hex8 1743.58 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Table 19.7: Relative proportions of neutral N-glycans from purified antibody, at day 5, from strains M627 and M629 cultivated in WSG medium in shake flasks. M627 M629 Composition Short mz % % Hex3HexNAc2 Man3 933.31 47.9 7.2 Hex4HexNAc2 Man4 1095.37 2.5 2.0 Hex3HexNAc3 GnMan3 1136.40 0.0 0.8 Hex5HexNAc2 Man5 1257.42 0.0 1.4 Hex3HexNAc4 GO 1339.48 21.1 56.9 Hex6HexNAc2 Hex6 1419.48 28.4 31.4 Hex7HexNAc2 Hex7 1581.53 0.0 0.4 Hex8HexNAc2 Hex8 1743.58 0.0 0.0 Example 20 - GENERATION OF GLcNACMAN5 PRODUCING STRAINS WITH DIFFERENT PROMOTERS [00535] Vectors for GnTI with different promoters are described in Table 20.1. The vectors were targeted into egl2 locus of T.reesei. 185 WO 2013/102674 PCT/EP2013/050126 Table 20.1: Description of Human GnTI vectors with different promoters. pTTgl53 pcDNA1-Kre2-GnTI to Eg12 pTTgl67 pcbhl-Kre2-GnTI to Eg12 pTTgl68 pgpdA-Kre2-GnTI to Eg12 pTTgl70 pgpdA-GnTI to Eg12 pTTg171 pcbhl-Kre2-GnTI to Eg12 (inactive GnTI) Materials and methods [00536] The generation strategy of fragments for vectors of Table 20.1 is presented in Table 20.2 and the primers used for fragment generation are listed on Table 20.3. Fragments were amplified by PCR and products were purified from the agarose gel. Digested pTTg 152 vector was purified from the gel. All PCR amplifications were made with high-fidelity Phusion polymerase (Finnzymes). Fragments for pTTgl53-pTTgl7l were electroporated to yeast Saccharomyces cerevisiae FY834 for plasmid assembly by homologous recombination. Yeast cells were plated to SC-ura for 2-3 days cultivation in +30 0 C. Colonies were then pooled from the plates and plasmid pool was purified with Phenol/Chloroform extraction method as routinely. Plasmid pool was transformed to competent E. coli cells by electroporation. Electroporated cells were plated to LB+amp selection plates, cultivated +37 0 C over night and colonies were screened by PCR. Positive colonies were then streaked to fresh plates as pure cultures, single colonies were cultured in liquid LB+amp media and potential vectors pTTgl53-pTTgl71 were purified according to standard protocols. Plasmids were analyzed by restriction analysis and sequences were verified by sequencing. Table 20.2: Construction strategy of the vectors. Vectors pTTv225, pTTv77, pTTg91 were used for construction of fragments specified on below. Vectors pTTv11O, pTTv141, pTTv11, and pTTv13 are described in the International Patent Application No. PCT/EP2011/070956. 186 WO 2013/102674 PCT/EP2013/050126 Vector Fragment 1 Fragment 2 Fragment 3 Fragment 4 code pTTg153 PCR product from PCR product from PCR product from pTTv77 cut with pTTv225 template pTTv1 1 template pTTv77 template Clal and Fsel GP346, GP471 GP472, GP345 GP348, GP349 >egl2 3' flank fragment sequence pTTg167 PCR product from PCR product from PCR product from pTTg152 cut pTTv1 10 template pTTv225 template pTTv1 1 template with Fsel and GP337, GP338 GP335, GP402 GP472, GP345 Ascl >cDNA1 promoter - Kre2 targeting signal fragment amplification pTTg168 PCR product from PCR product from PCR product from pTTg152 cut pTTv141 template pTTv225 template pTTv1 1 template with Fsel and GP343, GP347 GP335, GP402 GP472, GP345 Ascl pTTg170 PCR product from pTTg1 52 cut with n/a n/a pTTv13 template Fsel and Sall GP343, GP399 pTTg171 PCR product from PCR product from PCR product from pTTg152 cut pTTv1 10 template pTTv225 template pTTg91 template with Fsel and GP400, GP401 GP335, GP402 GP403, GP404 Sall Inactive Gntl fragment amplification Table 20.3: Primers used for construction of vectors OF Table 20.2 Code Sequence 5' > 3' GP335 ATGGCGTCAACAAATGCGCGCTATGT GP337 ATTCACACTCTCAGAATAAATTCATCGCCAATTTGACAGGCCGGCCATTCTCACGGT GAATGTAGGCCTTTTGTA GP338 TTAGTAGATAGCGCACATAGCGCGCATTTGTTGACGCCATGCGGTTGACTATTGGG TTTCTGTGCCTCAAAAGAT G P343 CACACTCTCAGAATAAATTCATCGCCAATTTGACAGGCCGGCCGCCCTTGTATCTCT ACACACAGGCTCAA G P345 CTGCAGTGCAGGATCTGCATATATG G P346 TTATTCACACTCTCAGAATAAATTCATCGCCAATTTGACAGGCCGGCCACTAGTGGT CTGAAGGACGTGG G P347 TTAGTAGATAGCGCACATAGCGCGCATTTGTTGACGCCATCTGATGTCTGCTCAAG CGGGGTA G P348 AGGACCTTAATTAATCATATATGCAGATCCTGCACTGCAGGCGGCCGCCACTCTGA GCTGAATGCAGAAGC G P349 CTTGACCTCGGAGAAAGTTACCCTCCTTTTGTCAGACACGATCGATTTCCAACAGAT GGAAAGAAGAAAGG GP399 AATACCGCCGCACTGGCCGTAGTGAGACTGGGTAGGTCGACTAATTCCAGCTGGG ATCATA GP400 CACACTCTCAGAATAAATTCATCGCCAATTTGACAGGCCGGCCAATTCTCACGGTG AATGTA G P401 TTAGTAGATAGCGCACATAGCGCGCATTTGTTGACGCCATGCGGTTGACTATTGGG TT 187 WO 2013/102674 PCT/EP2013/050126 GP402 TTCGAGGGCCGGGAGCGATGCCGA G P403 GGCTTCAACGACCTCGTCGGCATCGCTCCCGGCCCTCGAAACGCGCCCAGCACCT GGCA G P404 ATACCGCCGCACTGGCCGTAGTGAGACTGGGTAGGTCGACTAATTCCAGCTAGGA TCATA G P471 AGAATACCGGATTACTGATCCGGAGAATACTTTGTAAATAGCGGCCGCGGCTGATG AGGCTGAGAGAGG G P472 CAACGACCTCGTCGGCATCGCTCCCGGCCCTCGAATGAACGGGGATGCCCTGTCG AGC [00537] Trichoderma reesei MABO expression strain M507 with 7-fold protease deletion was transformed with the PmeI fragments of vectors pTTgl53-pTTgl7l targeted to egl2 locus. Variable amount of transformants were picked onto selective plates. On the basis of PCR screening with Phire Plant Direct PCR kit (Finnzymes F-130), clones with positive results concerning 5'- and 3'-integration were selected for single spore platings and re-screening for integration and egl2 deletion. PCR-screened strains were finally subjected to shake flask cultivation and glycan analysis. Shake flask cultures of strain M507 transformed with GnTI and promoter constructs [00538] Strain M507 transformed with vectors of Tables 20.1 and 20.2 were cultivated in shake flasks in TrMM, 4% lactose, 2% SGE, 100 mM PIPPS, pH5.5, at +28'C and sampling was performed at day 5. An inactive GnTI construct was tested to determine possible effects of GlcNAcMan5 glycans to growth of T. reesei. [00539] For N-glycan analysis MABO was purified, concentrations were determined and N glycans analysed with MALDI-TOF MS as described above. N-glycan analysis of MABO1 showed that GnMan5 levels ranged from 8 to 79.2 % of the total glycans (Tables 20.4 and 20.5A and B). The inactive GnTI produced wild type glycosylation as expected. Table 20.4: GnTI constructs and antibody concentrations. Strain numbers for selected clones are given in parentheses in "Clones" column. 188 WO 2013/102674 PCT/EP2013/050126 Focus/vector Clones Antibody titer g/L in ProtG eluent 33-6A 0.15 33-6B (M704) 0.14 34-6A 0.53 34-45A (M706) 0.51 pTTgl70 1A 0.55 2A (M710) 0.73 pTTg171 2A 0.7 6A (M712) 0.55 11A 1.03 23A (M702) 0.99 M507 0.68 Tables 20.5A and B: Relative pr portions of neutral N-glycans of MAB01, at day 5. Table A 1A 2A 34-6A 34-45A 33-6A 33-6B (pTTg170) Composition Short mz % % % % % % Hex3HexNAc2 Man3 933.31 0.0 0.0 0.0 0.0 0.0 0.0 Hex4HexNAc2 Man4 1095.37 0.0 0.0 0.0 0.0 0.0 0.0 Hex5HexNAc2 Man5 1257.42 85.0 74.3 24.5 19.6 5.0 5.8 Hex3HexNAc4 GO 1339.48 0.0 0.0 0.0 0.0 0.0 0.0 Hex6HexNAc2 Man6 1419.48 5.7 5.5 13.4 10.3 5.9 7.2 Hex5HexNAc3 GnMan5 1460.50 2.5 10.8 42.9 56.7 79.2 77.9 Hex7HexNAc2 Man7 1581.53 3.7 5.2 11.0 8.0 5.6 5.1 Hex8HexNAc2 Man8 1743.58 2.2 2.8 6.0 4.3 4.4 4.0 Hex9HexNAc2 Man9 1905.63 0.9 1.4 2.0 1.1 0.0 0.0 HexlOHexNAc2 ManlO 2067.69 0.0 0.0 0.2 0.1 0.0 0.0 2A Table B 6A 11A 23A (pTTg171) Composition Short mz % % % % Hex3HexNAc2 Man3 933.31 0.0 0.0 0.0 1.6 Hex4HexNAc2 Man4 1095.37 0.0 0.0 0.0 0.0 Hex5HexNAc2 Man5 1257.42 85.7 89.5 71.8 70.1 Hex3HexNAc4 GO 1339.48 0.0 0.0 0.0 0.0 Hex6HexNAc2 Man6 1419.48 6.1 4.3 10.5 7.2 Hex5HexNAc3 GnMan5 1460.50 0.0 0.0 8.0 12.2 189 WO 2013/102674 PCT/EP2013/050126 Hex7HexNAc2 Man7 1581.53 4.8 3.6 6.4 5.5 Hex8HexNAc2 Man8 1743.58 2.8 1.9 2.6 2.4 Hex9HexNAc2 Man9 1905.63 0.6 0.7 0.7 1.0 HexlOHexNAc2 Man1O 2067.69 0.0 0.0 0.0 0.0 Fermenter cultures of strain M507 transformed with GnTI constructs [00540] The T. reesei strains M702, M704, M706, M710, M712, M716 and M507 were fermented in 4% WSG, 2% Glc, 4% cellobiose, 6% lactose, pH 5.5, and sampling was performed at days 3-6. The antibody titers are shown in Table 20.6. N-glycans were detached and analysed as above described using PNGase F. [00541] N-glycan analysis of MABO showed that GnMan5 levels ranged from 1.8 to 68.5 % of the total glycans (Tables 20.7 A, B and C). The inactive GnTI produced wild type glycosylation as expected as did the control strain M507. Table 20.6: Antibody concentrations of MABO. Titer g/l Strain d3 d4 d5 d6 M702 1,23 1,72 2,14 2,34 M704 0,299 0,399 0,415 0,479 M706 0,293 1,04 1,65 2,04 M710 0,951 1,09 1,32 1,69 M712 1,34 1,93 2,34 2,4 M716 0,16 0,519 1,11 1,69 M507 1,04 1,81 2,24 2,3 190 WO 2013/102674 PCT/EP2013/050126 Table 20.7 A, B and C: Relative proportions of neutral N-glycans on MABO1, at day 3, 4, 5 and 6. Table A M702 M704 M706 d3 d4 d5 d6 d3 d4 d5 d6 d3 d4 d5 d6 Composition Short mz % % % % % % % % % % % % Hex4HexNAc2 Man4 1095,4 0,0 0,5 0,4 0,0 0,0 0,0 0,0 0,0 0,3 0,0 0,5 0,5 Hex5HexNAc2 Man5 1257,4 36,0 46,8 55,7 72,1 9,7 12,9 16,1 20,3 21,6 45,5 63,3 70,5 Hex6HexNAc2 Man6 1419,5 11,5 12,1 9,8 6,2 9,2 7,2 5,6 10,1 13,0 8,6 7,8 5,5 Hex5HexNAc3 GnMan5 1460,5 40,5 29,7 25,1 14,8 67,5 68,5 64,9 51,9 45,7 39,2 22,2 17,1 Hex7HexNAc2 Man7 1581,5 7,6 6,8 5,3 4,6 8,4 6,8 6,9 9,1 11,9 4,1 3,5 3,3 Hex8HexNAc2 Man8 1743,6 3,7 3,2 2,8 2,2 4,2 3,7 5,2 5,1 5,8 2,1 2,0 2,2 Hex9HexNAc2 Man9 1905,6 0,8 0,8 0,7 0,0 1,0 0,8 1,1 3,4 1,5 0,5 0,4 0,4 Hex1OHexNAc2 Man1O 2067,7 0,0 0,1 0,1 0,0 0,0 0,0 0,2 0,0 0,3 0,0 0,2 0,3 Table B M710 M712 d3 d4 d5 d6 d3 d4 d5 d6 Composition Short mz % % % % % % % % Hex4HexNAc2 Man4 1095,4 0,4 0,3 0,4 0,0 0,0 0,0 0,3 0,0 Hex5HexNAc2 Man5 1257,4 72,0 72,6 78,5 84,2 76,7 85,0 85,6 89,8 Hex6HexNAc2 Man6 1419,5 13,9 13,4 11,0 6,3 12,4 8,4 7,6 4,2 Hex5HexNAc3 GnMan5 1460,5 2,5 3,3 2,1 3,5 0,0 0,0 0,0 0,0 Hex7HexNAc2 Man7 1581,5 7,5 6,8 5,0 3,6 7,4 4,4 4,1 3,3 Hex8HexNAc2 Man8 1743,6 3,3 2,9 2,6 1,8 2,7 2,1 1,9 2,1 Hex9HexNAc2 Man9 1905,6 0,5 0,6 0,4 0,5 0,7 0,0 0,4 0,6 HexlOHexNAc2 Man1O 2067,7 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 Table C M716 M507 d3 d4 d5 d6 d3 d4 d5 d6 Composition Short mz % % % % % % % % Hex4HexNAc2 Man4 1095,4 0,0 0,0 0,3 0,4 0,0 0,4 0,0 0,0 Hex5HexNAc2 Man5 1257,4 62,1 73,8 84,8 85,5 70,7 79,5 87,3 89,6 Hex6HexNAc2 Man6 1419,5 14,9 10,0 7,2 7,8 17,2 12,5 8,1 5,4 Hex5HexNAc3 GnMan5 1460,5 4,3 4,2 1,8 1,9 0,0 0,0 0,0 0,0 Hex7HexNAc2 Man7 1581,5 12,8 8,0 4,2 3,0 8,8 5,0 3,5 2,6 Hex8HexNAc2 Man8 1743,6 5,1 3,4 1,5 1,2 2,8 2,1 1,1 1,9 Hex9HexNAc2 Man9 1905,6 0,8 0,6 0,4 0,3 0,5 0,5 0,0 0,4 HexlOHexNAc2 Man1O 2067,7 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 191 WO 2013/102674 PCT/EP2013/050126 Example 21 - GENERATION OF GLcNACMAN5 PRODUCING STRAINS WITH DIFFERENT TARGETING PEPTIDES Generation of Plasmids [00542] Plasmids used in generating GNT1 strains with different Golgi targeting peptides (pTTv274, pTTv275, pTTv276, pTTv278, pTTv279, pTTv280) were all based on the common parental plasmid pTTv265 which contains human GNT1 (P26572) with a 38 amino acid N terminal truncation. Pedigree of pTTv265 is summarised in Table 21.1. Table 21.1: Pedigree of Golgi targeting peptide plasmids pTTv274, pTTv275, pTTv276, pTTv278, pTTv279, pTTv280. Golgi targeting peptides were added to pTTv265 generating the aforementioned plasmids. plasmid content pTTv77 egl2 5' and 3' flanks, cbhl promoter, pyr4 loopout marker, pRS426 backbone pTTv256 promoter change to pTTv77: cbhl to gpdA pTTv264 selection marker change to pTTv256: pyr4 loopout to hygromycin pTTv265 human GNT1 (del38 aa) added to pTTv264 Stepwise Description of Generation of Plasmids [00543] Plasmid pTTv77 contains egl2 (tre120312) 5' and 3'flanking regions for targeted integration to T. reesei genome and cbh1 promoter for gene expression. Integration of plasmid pTTv77 to genome results in 2456 bp deletion in egl2 locus. 1020 bp and 1024 bp regions from egl2 locus were amplified for 5' and 3'flanks. 2176 bp from cbh1 locus was amplified for promoter fragment. Template used in the PCR reactions was genomic DNA of T. reesei. Primer used in PCR reactions are shown in Table 21.2. Selection marker pyr4 blaster cassette was a Nod fragment from pTTv71 described above and vector backbone was EcoRI/XhoI digested pRS426 described above. All fragments were purified using standard laboratory methods and plasmid was cloned by yeast recombination method as described in Examples. After plasmid rescue to E. coli a few clones were verified for correct recombination. Stored clone was verified by sequencing. 192 WO 2013/102674 PCT/EP2013/050126 Table 21.2: Primers used in cloning pTTv77. Primer name Primer sequence T575_eg|2_5'flankF GATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACG GTTTAAACTCCAAAGTTCCTGTCTTCTCC T576_eg|2_5'flankR TGTCAAATTGGCGATGAATTTAT T577_eg12-cbh1_prom+termF TTATTCACACTCTCAGAATAAATTCATCGCCAATTTGACA GGCCGGCCGGGTAGGAATTGTCACTCAAG T572_cbh Iprom+termR GCAACGAGAGCAGAGCAGCAGTAGTCGATGCTAG GCGGCCGCGGCCGCTCATCGTCTTGACAGCAATGC T578_eg|23'flankF ACCAGCCGCAGCCTCAGCCTCTCTCAGCCTCATCAGCCGC GCGGCCGCCACTCTGAGCTGAATGCAGA T579_eg|23'flankR CCTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACA GTTTAAACGCGCTGCCTCCACGATGT [00544] Plasmid pTTv256 is based on plasmid pTTv77. In plasmid pTTv256 promoter cbh1 was changed to gpdA. To clone pTTv256, plasmid pTTv77 was digested with FseI/PacI to release cbh1 promoter. New promoter, A. nidulans gpdA was released from a plasmid with FseI/PacI digestion. Fragment purification and cloning were performed using standard laboratory methods. A few clones were verified for correct ligation. Stored clone was verified by sequencing. [00545] Plasmid pTTv264 is based on plasmid pTTv256. In pTTv264 selection marker was changed from pyr4 blaster cassette to hygR selection marker. To clone pTTv264, plasmid pTTv256 was digested with Nod to release pyr4 blaster cassette. Marker hygR was amplified by PCR using modified pRLMex30 as a template with primers shown in Table 21.3. All fragments were purified using standard laboratory methods ad plasmid was cloned by yeast recombination method described in Examples. After plasmid rescue to E. coli a few clones were verified for correct recombination and stored clone was verified by sequencing. Table 21.3: Primers used in cloning pTTv264. Primer name Primer sequence T974-Cbh1t+Notl+PKI promoter 5'end GACCAACTTGTCCGTTGCGAGGCCAACTTGCATTGCTGT CAAGACGATGAGCGGCCGCATAACGGTGAGACTAGCGGC T942_pTTv256_3'end+Notl+tcbh2_rev ATACAAACGTTGGCGAGGCTTCTGCATTCAGCTCAGAGTG GCGGCCGCGTGCTGCGGAATCATTATCATCTG 193 WO 2013/102674 PCT/EP2013/050126 [00546] Plasmid pTTv265 is based on plasmid pTTv264 described above. In pTTv265 human GNT1 with N-terminal truncation of 114 nucleic acids (38 amino acids) was added under gpdA promoter. To clone pTTv265, plasmid pTTv264 was linearized with PacI. Human GNT1 was amplified by PCR from synthetic plasmid pTTv 11 carrying full-length human GNT1 gene (P26572, pTTvl 1 is also described in the International Patent Application No. PCT/EP2011/070956). Primers used in amplification are shown in Table 21.4. All fragments were purified using standard laboratory methods. Plasmid was cloned by yeast recombination method described above. After plasmid rescue to E. coli a few clones were verified for correct recombination and stored clone was verified by sequencing. Table 21.4: Primers used in cloning pTTv265. Primer name Primer sequence T943_GPDAp+TC+Pacl+GNT1_F GCAGCTTGACTAACAGCTACCCCGCTTGAGCAGACATCA TCTTAATTAATCAGTCAGCGCTCTCGATGGC T944_Cbh1t(pTTv256)+Swal+GNT1_R CCAATACCGCCGCACTGGCCGTAGTGAGACTGGGTAG GTCATTTAAATCTAATTCCAGCTGGGATCATAG [00547] The human N-terminal 38 amino acid truncated GnTI amino acid sequence in the plasmid pTTvl 1 for constructing pTTv265. [00548] SVSALDGDPASLTREVIRLAQDAEVELERQRGLLQQIGDALSSQRGRVPTAAP PAQPRVPVTPAPAVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQAIA SYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVEDDL EVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWL LLAELWAELEPKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHGQFFDQH LKFIKLNQQFVHFTQLDLSYLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRV QYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPPTWEGYDPSW N [00549] Plasmids pTTv274, pTTv275, pTTv276, pTTv278, pTTv279 and pTTv280 were all based on plasmid pTTv265 described above. In these plasmids different Golgi targeting peptides were added to precede the N-terminally truncated human GNT1 gene. To clone these plasmids, 194 WO 2013/102674 PCT/EP2013/050126 pTTv265 was linearized with PacI. Different Golgi targeting peptides were amplified by PCR using primers shown in Table 21.5A. Template DNA for GNT2 (pTTv274) was synthetic plasmid carrying codon harmonised human GNT2 gene from the International Patent Application No. PCT/EP2011/070956). Template for other Golgi targeting peptides (pTTv276, pTTv278, pTTv279, pTTv280) was T. reesei genomic DNA. KRE2 (pTTv275) was produced by PCR using annealing primers in Table 21.5A. All fragments were purified using standard laboratory methods and plasmids were cloned by yeast recombination method as described Examples. After plasmid rescue to E. coli a few clones from each cloning were verified for correct recombination and stored clones were verified by sequencing. Table 21.5A: Primers used to produce Golgi targeting peptides in pTTv274, pTTv275, pTTv276, pTTv278, pTTv279 and pTTv280. Plasmid Primer Primer sequence pTTV274 T945_GNT2-gts-f GCAGCTTGACTAACAGCTACCCCGCTTGAGCAGACAT CATCATGCGCTTCCGAATCTACAAG T946_GNT2-gts-r GGGTGAGGCTGGCGGGGTCGCCATCGAGAGCGCTG ACTGAGGGGTGATCCCCTCCCCTG pTTv275 Ti 117KRE2-gts- GCAGCTTGACTAACAGCTACCCCGCTTGAGCAGACAT cds-F CATCATGGCGTCAACAAATGCGCGCTATGTGCGCTAT CTACTAATCGCCTTCTTCACAATCC T1 118_KRE2-gts-cds-mid-F TACTAATCGCCTTCTTCACAATCCTCGTCTTCTACTTTG TCTCCAATTCAAAGTATGAGGGCGTCGATCTCAACAA GGGCACCTT T1 119_KRE2-gts-cds-R GGGTGAGGCTGGCGGGGTCGCCATCGAGAGCGCTGA CTGACTTTGGTGTCGTCTTGGTCGAATCCGGAGCTGTG AAGGTGCCCTTGTTGAGATCGACGC T1 120_gpdAp 3prim-F GCAGCTTGACTAACAGCTAC T1121_GNT1 5end-R GGGTGAGGCTGGCGGGGTC pTTv276 T949_KRE2-like-gts-f GCAGCTTGACTAACAGCTACCCCGCTTGAGCAGACAT CATCATGGCCATTGCCCGGCCGGT T950_KRE2-like-gts-r GGGTGAGGCTGGCGGGGTCGCCATCGAGAGCGCTG ACTGAGCCCGTGGCTATCAAGAAGAAGAC pTTv278 T9530ch1 -gts-f GCAGCTTGACTAACAGCTACCCCGCTTGAGCAGACAT CATCATGTTGAATCCACGCCGCG T954_Och1 -gts-r GGGTGAGGCTGGCGGGGTCGCCATCGAGAGCGCTG ACTGAGGACGTCGAGGCCGATTCG pTTv279 T955_Anp1 -gts-f GCAGCTTGACTAACAGCTACCCCGCTTGAGCAGACAT CATCATGATGCCACGGCATCACTC T956_Anp1 -gts-r GGGTGAGGCTGGCGGGGTCGCCATCGAGAGCGCTG ACTGATTCGAGCTTCAGGTCATCGT pTTv280 T957_Van1 -gts-f GCAGCTTGACTAACAGCTACCCCGCTTGAGCAGACAT CATCATGCTGCTCCCCAAGGGCG 195 WO 2013/102674 PCT/EP2013/050126 T958_Van1 -gts-r GGGTGAGGCTGGCGGGGTCGCCATCGAGAGCGCTG ACTGACTCAGATGCCGAAGTGGACAC Table 21.5B: Amino acid sequence of targeting peptides in plasmids of Table 21.5A. Plasmid Protein TrelD Amino acid sequence pTTV274 human GNT2 - MRFRIYKRKVLILTLVVAACGFVLWSSNGRQR KNEALAPPLLDAEPARGAGGRGGDHP (SEQ ID NO:589) pTTv275 KRE2 21576 MASTNARYVRYLLIAFFTILVFYFVSNSKYEGV DLNKGTFTAPDSTKTTPK (SEQ ID NO:590) pTTv276 KRE2-like 69211 MAIARPVRALGGLAAILWCFFLYQLLRPSSSY NSPGDRYINFERDPNLDPTG (SEQ ID NO:591) pTTv278 Och1 65646 MLNPRRALIAAAFILTVFFLISRSHNSESASTS (SEQ ID NO:592) pTTv279 Anp1 82551 MMPRHHSSGFSNGYPRADTFEISPHRFQPRA TLPPHRKRKRTAIRVGIAVVVILVLVLWFGQPR SVASLISLGILSGYDDLKLE (SEQ ID NO:593) pTTv280 Van1 81211 MLLPKGGLDWRSARAQIPPTRALWNAVTRTR FILLVGITGLILLLWRGVSTSASE (SEQ ID NO:594) Generation of Strains with Different Golgi Targeting Peptides For GNT1 [00550] Fragments for transformations were released from plasmids pTTv274 (GNT2), pTTv275 (KRE2), pTTv276 (KRE2-like), pTTv278 (OCHI), pTTv279 (ANPI) and pTTv280 (VANI) (Tables 21.5A and 21.5B) with PmeI. All fragments were transformed individually to MABO expressing strain M507 and protoplast transformations were carried out essentially as described in Examples for hygromycin selection. [00551] Well growing clones on selective streaks were screened for the 5' and 3' integration into the egl2 locus. Double integration-positive clones were additionally screened for the loss of the egl2 ORF. The clones giving the desired results were purified through single spore platings, and the single spore-derived clones were verified by PCR to be pure integration strains. Resulting strains are listed in Table 21.6 below. 196 WO 2013/102674 PCT/EP2013/050126 Table 21.6: Summary of the GnTI Golgi targeting peptide strains. Strain Plasmid Targeting TrelD peptide M607 pTTv274 Human GNT2 M685 pTTv275 Kre2 21576 M610 pTTv276 Kre2-like 69211 M615 pTTv278 Och1 65646 M620 pTTv279 Anp1 82551 M622 pTTv280 Van1 81211 [00552] Fermentation of strains M507, M607, M610, M615, M620, M622, and M685 and glycan analysis [00553] The T. reesei strains M507, M607, M610, M615, M620, M622, and M685 were fermented in 4% whole spent grain, 2% glucose, 4% cellobiose, 6% lactose, pH 5.5, and sampling was performed at days 3-6. The antibody titers are shown in Table 21.7. N-glycans were detached and analysed as above described using PNGase F. [00554] N-glycan analysis of MABO showed that GnMan5 levels ranged from 4 to 66 % of the total glycans (Table 21.8 A, B and C). The control strain M507 showed wild type glycosylation as expected. Table 21.7: Antibody concentrations from strains with human GnTI with different targeting peptides. Titer g/l Strain d3 d4 d5 d6 M507 0,882 1,54 1,94 2,09 M607 0,536 1,45 2,22 2,28 M610 0,352 1,04 1,87 2,19 M615 0,554 1,15 1,76 1,9 M620 0,559 1,24 1,95 2,21 M622 0,697 1,36 1,8 2,04 M685 0,388 1,05 1,94 2,44 197 WO 2013/102674 PCT/EP2013/050126 Table 21.8 A, B and C: Relative proportions of neutral N-glycans of MABO1, at day 3, 4, 5 and 6, from strains with human GnTI with different targeting peptides. Ta ble A M507 M607 M610 d3 d4 d5 d6 d3 d4 d5 d6 d3 d4 d5 d6 Composition Short mz % % % % % % % % % % % % Hex4HexNAc2 Man4 1095,4 0,3 0,0 0,0 0,0 0,0 0,2 0,0 0,0 0,0 0,0 0,0 0,2 Hex5HexNAc2 Man5 1257,4 79,3 89,4 88,4 93,6 11,5 24,7 37,0 42,8 29,4 44,5 68,8 74,3 Hex4HexNAc3 GnMan4 1298,5 0,0 0,0 0,0 0,0 0,2 0,2 0,0 0,0 0,0 0,0 0,0 0,0 Hex6HexNAc2 Man6 1419,5 12,3 7,0 7,0 3,9 8,8 7,4 4,0 2,5 7,0 6,3 6,2 2,9 Hex5HexNAc3 GnMan5 1460,5 0,0 0,0 0,0 0,0 66,1 59,4 56,0 49,6 52,5 44,0 21,1 18,9 Hex7HexNAc2 Man7 1581,5 6,3 2,6 3,2 1,9 8,6 4,8 1,9 3,5 7,3 3,7 2,7 2,7 Hex6HexNAc3 GnMan6 1622,6 0,0 0,0 0,0 0,0 1,8 0,7 0,0 0,0 1,0 0,4 0,0 0,0 Hex8HexNAc2 Man8 1743,6 1,6 1,0 1,2 0,7 2,8 2,2 0,9 1,2 2,1 1,1 1,1 0,8 Hex9HexNAc2 Man9 1905,6 0,3 0,0 0,3 0,0 0,3 0,2 0,2 0,4 0,7 0,0 0,1 0,2 HexlOHexNAc2 Man1O 2067,7 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 Table B M615 M620 d3 d4 d5 d6 d3 d4 d5 d6 Composition Short mz % % % % % % % % Hex4HexNAc2 Man4 1095,4 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,2 Hex5HexNAc2 Man5 1257,4 21,7 36,4 54,1 51,5 22,0 35,5 50,8 63,9 Hex4HexNAc3 GnMan4 1298,5 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 Hex6HexNAc2 Man6 1419,5 10,7 7,7 6,3 4,2 10,5 6,6 5,5 4,3 Hex5HexNAc3 GnMan5 1460,5 57,0 50,1 36,5 38,8 57,3 53,0 40,5 28,0 Hex7HexNAc2 Man7 1581,5 7,4 3,9 2,0 3,6 7,2 3,3 2,3 2,4 Hex6HexNAc3 GnMan6 1622,6 0,8 0,3 0,0 0,3 1,2 0,4 0,0 0,0 Hex8HexNAc2 Man8 1743,6 2,4 1,4 1,0 1,3 1,6 1,1 0,9 1,1 Hex9HexNAc2 Man9 1905,6 0,0 0,2 0,0 0,4 0,3 0,2 0,0 0,1 HexlOHexNAc2 ManlO 2067,7 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 Table C M622 M685 d3 d4 d5 d6 d3 d4 d5 d6 Composition Short mz % % % % % % % % Hex4HexNAc2 Man4 1095,4 0,0 0,0 0,0 0,2 0,0 0,0 0,0 0,0 Hex5HexNAc2 Man5 1257,4 63,8 77,9 85,6 85,0 29,7 43,1 70,3 78,3 Hex4HexNAc3 GnMan4 1298,5 0,0 0,0 0,0 0,0 0,0 0,0 0,0 0,0 Hex6HexNAc2 Man6 1419,5 15,0 9,1 7,3 4,9 6,5 6,5 5,2 3,8 Hex5HexNAc3 GnMan5 1460,5 6,4 7,8 4,1 4,9 56,3 44,9 21,7 14,7 Hex7HexNAc2 Man7 1581,5 10,7 4,0 2,3 3,5 4,8 3,7 2,0 2,1 Hex6HexNAc3 GnMan6 1622,6 0,5 0,0 0,0 0,0 0,9 0,3 0,0 0,0 Hex8HexNAc2 Man8 1743,6 3,3 1,1 0,6 1,2 1,9 1,2 0,7 1,1 Hex9HexNAc2 Man9 1905,6 0,3 0,2 0,0 0,2 0,0 0,2 0,0 0,0 HexlOHexNAc2 ManlO 2067,7 0,0 0,0 0,0 0,1 0,0 0,0 0,0 0,0 198 WO 2013/102674 PCT/EP2013/050126 Example 22 - SILENCING OF SLP GENES VIA RNAI AND DELETION OF SLP2 [00555] Three silencing constructs were constructed for knocking down the expression of slp2 (tre123244). These RNAi constructs contain a gpdA promoter, targeted integration to the pep2 (tre53961) protease locus, and a pyr4 loop-out marker with 3' pep2 direct repeat. Two short 19 bp target sequences and a large 448 bp sequence were inserted into this vector to create pTTv2l7, pTTv218, and pTTv263, respectively. These vectors were designed to knockdown the expression of slp2 and reduce its protease activity. The RNAi vectors were transformed into the pyr4 version of the MAB01 production strain M507. The pTTv204 vector is shown in Figure 52. [00556] The pTTv204 RNAi expression vector was linearized with the AsiSI restriction enzyme. The primers T846 and T847 were annealed together and integrated via yeast recombination into the pTTv204 vector. The primers are shown in Table 22.1. The 19 base pair target sequence is contained in the resulting pTTv2l7 vector. The primers T848 and T849 were annealed together and integrated into the linearized pTTv204 vector to create the pTTv218 RNAi vector. This vector contains a 19 base pair target sequence. The primers are shown in Table 22.1. The target sequences are shown in Table 22.2. [00557] The pTTv263 vector was made in two pieces and integrated into the pTTv204 vector. The primers T965 and T967 were used to amplify a 506 base pair sense fragment including the 58 base pair intron sequence in the slp2 gene. The pTTv204 vector was opened with the AsiSI restriction enzyme and the 506 sense fragment was integrated into the vector via yeast recombination. The primers T1006 and T1007 were used to amplify an antisense fragment of 448 base pair. The antisense fragment was digested with FseI and AscI restriction enzymes. The vector including the sense fragment was also digested with FseI and AscI. The vector and antisense fragment were ligated together to create the vector pTTv263. The primers are listed in Table 22.1. The target sequence is shown in Table 22.2. [00558] The pTTv2l7, pTTv218, pTTv263 RNAi vectors were digested with PmeI to release the expression cassette. The fragments were separated with agarose gel electrophoresis and the correct fragments were isolated with a gel extraction kit (Qiagen) using standard laboratory 199 WO 2013/102674 PCT/EP2013/050126 methods. Approximately 5 tg of the expression cassette was used to transform the MABO antibody expression strain M507 (pyr4- version). Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00559] The short target sequence in the pTTv2l7 vector was designed to specifically affect only slp2. The pTTv2l8 target sequence was homologous to slp3, slp5, and slp6. The large 448 bp target sequence in pTTv263 vector was meant to affect several subtilisins. The target sequences in these vectors are listed in Table 22.2. The resulting knockdown strains M665, M666, and M667 were cultivated in small scale cultures. [00560] Several pTTv2l7, pTTv2l8, and pTTv263 transformants were grown in 24 well cultures to compare their MABO production against the control strain M507. The strains were grown in TrMM with diammonium citrate without ammonium sulfate, 100 mM PIPPS, 2% spent grain extract, 4% lactose at pH 5.5. Duplicate wells were used for each transformant. Samples from the 24 well cultures taken on day 6 were used for immunoblotting. The supernatant was diluted with sodium citrate buffer pH 5.5, so that 0.5 p1I of each supernatant could be loaded into the 4-15% Criterion gel. Mixed with LSB+BME and heated at 95'C for 5 minutes. The proteins were transferred to nitrocellulose with the Criterion blotter at 100 volts for 30 minutes. The nitrocellulose membrane was blocked with 5% milk in TBST for 1 hour. The heavy chain was detected with anti-heavy chain AP conjugate antibody (Sigma #A3188) diluted 1:10,000 in TBST. After 1 hour incubation with the detection antibody, the blot was washed with TBST, and the membrane developed with AP substrate (Promega). [00561] The results can be seen in Figure 53. The 217.12G transformant produced slightly higher amounts of heavy chain compared to M507 or the second transformant 217.12E. The most noticeable improvement was observed with the pTTv218 transformants. Three transformants were significantly higher than the control. The 218.25F was the obvious standout. The results for the pTTv263 transformants were more variable. Two transformants produced very little antibody heavy chain. Transformant 263.11 OF seemed to produce twice as much heavy chain as the control. 200 WO 2013/102674 PCT/EP2013/050126 [00562] The constructs that targeted multiple proteases were more successful at improving the heavy chain expression. Overall, the pTTv218 transformants were consistently better than the M507 control. The lack in production seen in two of the pTTv263 transformants indicated that the RNAi worked too well. When the slp2 gene was deleted the growth of the strain suffered and thus the antibody expression reduced as well. The 263.36A and 263.124C transformants grow very poorly and expressed very little slp2. This was confirmed by shake flask and qPCR studies. [00563] Dry weight measurements from shake flask cultures can be seen in Table 22.5. The strains were grown in TrMM with diammonium citrate without ammonium sulfate, 100 mM PIPPS, 2% spent grain extract, 4% lactose at pH 5.5. Duplicate flasks were used for each transformant. The 263.124C transformant had difficulty growing. Generally, there was a small reduction in growth in all the strains that expressed RNAi. This effect may be related to lower slp2 expression levels. [00564] To confirm that slp2 expression was indeed reduced by the expression of RNAi, qPCR studies were done with the shake flask study mycelia. RNA was purified from shake flask culture mycelia, cDNA was synthesized, and qPCR analysis made. The slp2, slp3, slp5, slp6, and gpd1 expression were monitored with gene specific primers. Fold changes were measured against a control strain. The expression was normalized with gpd1. [00565] The 263.124C transformant showed the biggest downregulation of slp2 (Table 22.6). The large RNAi induced 36-fold downregulation of the slp2 gene, to a point where it was nearly turned off. The other transformants showed a much milder knockdown activity ranging from 1.2 to 2.5-fold. The milder knockdown is more preferred because the strain grows better and can produce good levels of antibody. [00566] With two transformants it was looked more closely at what other subtilisins were affected by the RNAi expression. In the 263.124C transformant it was evident that slp3 and slp6 were also knocked down by 6- and 2.3-fold, respectably. With the milder knockdown strain 218.25F both slp2 and slp3 showed reduced expression by 1.7- and 1.8-fold. 201 WO 2013/102674 PCT/EP2013/050126 Generation of 8-Fold Deletion Strain M646 Including Slp2 deletion [00567] The M646 slp2 deletion strain was made by transforming the pTTv1 15 deletion cassette into M564 (pyr4- version of M507). The M564 pyr4- strain was created essentially as described in Example 3 for removal of the pyr4 blaster cassette from the strain M195 (Apepl). Consecutive 5-FOA selection steps were carried out to ensure that the clones selected were originating from single cells. [00568] The deletion cassette containing the slp2 flanks and pyr4 marker was removed from the vector via PmeI digestion and the correct fragment was purified from an agarose gel using a QlAquick Gel Extraction Kit (Qiagen). Approximately 5 tg of the deletion cassette was used to transform the MABO production strain M564 (ApeplAtsplAslplAgaplAgap2Apep4Apep3, pyr4-). Preparation of protoplasts and transformation were carried out essentially as described in Example 1 for the strains M181 and M195 using pyr4 selection. [00569] Transformants were picked as first streaks. Growing streaks were screened by PCR (using the primers listed in Table 22.3) for correct integration and loss of slp2 ORF. Clones giving the expected signals were purified to single cell clones and rescreened by PCR using the primers listed in Table 22.3. The correct clone was designated as strain M646. Fermentation of strains M507, M665, M666, M667, and M646 [00570] The M507 strain was cultivated in fermentor cultivation series FTR104 under the same conditions as M665, M666, M667, and M646. The M646 was the slp2 deletion strain. The M665, M666, and M667 were strains with RNAi silencing. The FTR104 cultivations were grown in Trichoderma minimal medium (TrMM) plus 20 g/L yeast extract, 40 g/L cellulose, 80 g/L cellobiose, and 40 g/L sorbose at pH 5.5. The temperature was shifted from 28'C to 22'C after 48 hours. The cultures were grown for 6 days. Trichoderma minimal medium contains 5 g/L ammonium sulphate, 5 g/L potassium dihydrogen phosphate, 1 ml/L trace elements, 4.1 ml of IM calcium chloride per L, and 2.4 ml of IM magnesium sulphate per L of medium. 202 WO 2013/102674 PCT/EP2013/050126 [00571] Total antibody concentrations were determined from day 3-6. On day 6, the M667 strain reached 3.81 g/L, see Table 22.8. After day 5 the expression of antibody dropped in the M507, M665, and M666 cultivations. On day 6 the M507 strain produced 2.2 g/L, M665 reached 2.7 g/L, and M666 made 2.8 g/L. Thus the strains with the small RNAi target sequences produced slightly more antibody than M507 indicating that the silencing is working in those strains. The strain M646 with the slp2 deletion grew more slowly than the other strains. The slp2 deletion strain produced slightly over 2 g/L on day 6. Fermentation of strains M507, M665, M666, and M667 [00572] The 217.12G (M665), 218.25F (M666), and 263.110F (M667) were grown in 1 L fermentors with 30 g/l glucose, 60 g/l lactose, 20 g/l WSG, 20 g/l SGE plus lactose feeding at pH 5.5 starting at 28'C and shifted to 22'C later in the culture. The MABO heavy and light chain expression was assayed by immunoblotting from supernatant samples collected each day of the culture. The supernatants were diluted in pH 5.5 citrate buffer, so that 0.1 p1I could be loaded per well. LSB+BME was added and heated together for 5 minutes at 95'C. The samples were loaded into a 4-15% Criterion SDS PAGE gel. The proteins were transferred to nitrocellulose with the Criterion blotter at 100 volts for 30 minutes. The nitrocellulose membrane was blocked with 5% milk in TBST for 1 hour. The heavy chain was detected with anti-heavy chain (Sigma #A3188) and anti-light chain (Sigma #A3813) AP conjugated antibody diluted 1:10,000 in TBST. After 1 hour incubation with the detection antibody, the blot was washed with TBST, and the membrane developed with AP substrate (Promega). [00573] The total antibody expression was measured after protein G purification and the values are presented in Table 22.4, along with the results from two control strains. The M507 strain was cultivated with and without SBTI inhibitor under the same conditions. The expression levels of MABO in the M667 strain were higher than those measured in the M507 parent strain. On day 9, for instance, the expression level was twice as high for M667. The expression levels observed with M667 resembled the cultivation done with addition of SBTI. The M665 and M666 strains produced levels slightly lower or similar to the control. There was a clear 2-fold increase in antibody expression compared to the standard M507 strain. 203 WO 2013/102674 PCT/EP2013/050126 [00574] The protease activity from the cultivations listed in Table 22.4 was measured in order to determine how the total protease activities were affected by the RNAi. The protease activity measurements with casein as the substrate can be seen in Table 22.9. The total protein concentrations from all the supernatant samples were measured. The total protein concentration for all samples was normalized in sodium citrate buffer pH 5.5 to 0.625 mg/ml for all days of the cultivation. [00575] 100 l of all the diluted supernatants were added into the 96 well plate. Three replicate wells per sample were made. Added 100 p1I of casein FL diluted stock (10 p g/ml) made in sodium citrate buffer pH 5.5. The casein stock solution from the vial was 1000 P g/ml diluted in 200 l of PBS. For each sample a background control was included with 100 PI of diluted supernatant and 100 p1I of sodium citrate buffer pH 5.5. Incubated plates containing supernatants and substrate covered in a plastic bag at 37 0 C. The fluorescence was measured in the plates after 4 hours of incubation. The readings were done on a fluorescent plate reader using 485 nm excitation and 530 nm emission. [00576] The protease activity in the supernatant of the M665 strain was the lowest overall. Throughout the culture it was almost half that of M507. The large hairpin vector M667 activity was low as well, but it began to decrease after day 5 and was lowest on day 10. This was where the antibody production for the M667 strain was highest, on day 10. At the end of the culture both the M665 and M667 culture supernatants had half the protease activity as compared to the M507 control. When the M507 culture was supplemented with SBTI protease inhibitor, the protease activity also dropped from day 6 until day 8 and remained lower than the M507 strain. The low protease activity at the end of the culture explains why the M667 strain produced twice as much antibody as compared to the M507 strain. Table 22.1: Primers used for creation of the silencing vectors. Primer Sequence T846_pTTv217_top CTTGAGCAGTTAATTAATTTGAATGGCCGGCCGCACACTTTCAAG ATTGGCTTCAAGAGAGCCAATCTTGAAAGTGTGCTTGCGATCGCG GATCCACTTAACGTTACTGAAATCAT T847_pTTv217_bottom ATGATTTCAGTAACGTTAAGTGGATCCGCGATCGCAAGCACACTT TCAAGATTGGCTCTCTTGAAGCCAATCTTGAAAGTGTGCGGCCGG 204 WO 2013/102674 PCT/EP2013/050126 CCATTCAAATTAATTAACTGCTCAAG T848_pTTv218_top CTTGAGCAGTTAATTAATTTGAATGGCCGGCCGTACGGTGTTGCC AAGAAGTTCAAGAGACTTCTTGGCAACACCGTACTTGCGATCGCG GATCCACTTAACGTTACTGAAATCAT T849_pTTv218_bottom ATGATTTCAGTAACGTTAAGTGGATCCGCGATCGCAAGTACGGTG TTGCCAAGAAGTCTCTTGAACTTCTTGGCAACACCGTACGGCCGG CCATTCAAATTAATTAACTGCTCAAG T965_fwsenseloop-ascl CCGCTTGAGCAGTTAATTAATTTAAATGGCCGGCCTATATGGCGC GCCGTAAGTTTTGCACAGCCGC T967_revsenseloop-asisl GTCAAGCTGTTTGATGATTTCAGTAACGTTAAGTGGATCCGCGAT CGCCGTACTCGACGCCCTTGAC T1006_revantisensefsel CCTTATTCCTTTGAACCTTT T1007_fw antisense aseI GCAACGTGCTCAGGAGTTGC Table 22.2: Target sequences in the RNAi vectors. Name Target sequence pTTv217 GCACACTTTCAAGATTGGC pTTv218 GTACGGTGTTGCCAAGAAG pTTv263 GTTGAGTACATCGAGCGCGACAGCATTGTGCACACCATGCTTCCCCTCGAGTCCA AGGACAGCATCATCGTTGAGGACTCGTGCAACGGCGAGACGGAGAAGCAGGCTC CCTGGGGTCTTGCCCGTATCTCTCACCGAGAGACGCTCAACTTTGGCTCCTTCAAC AAGTACCTCTACACCGCTGATGGTGGTGAGGGTGTTGATGCCTATGTCATTGACA CCGGCACCAACATCGAGCACGTCGACTTTGAGGGTCGTGCCAAGTGGGGCAAGA CCATCCCTGCCGGCGATGAGGACGAGGACGGCAACGGCCACGGCACTCACTGCT CTGGTACCGTTGCTGGTAAGAAGTACGGTGTTGCCAAGAAGGCCCACGTCTACGC CGTCAAGGTGCTCCGATCCAACGGATCCGGCACCATGTCTGACGTCGTCAAGGGC GTCGAGTACG Table 22.3: Primers for screening pTTv115/Aslp2-pyr4 cassette integration and strain purity. For screening integration of pTTv115 (Aslp2-pyr4) Primer Sequence T054_slp2_5screenF GATGCACCGCTGCGGCC (SEQ ID NO: 327) T1084_screen_5flk-pyrjrev TCTTGAGCACGACAATCGAC T055_slp2_3screenR GGCGTTGCTCCCCATGCG (SEQ ID NO: 330) T028_Pyr4_flank rev CATCCTCAAGGCCTCAGAC (SEQ ID NO: 329) For screening deletion of slp2 (tre123244) ORF Till1slp2_ORFF ATGCGGTCCGTTGTCGCC (SEQ ID NO: 331) TI 12_slp2_ORFR TTACTCGGAGAGCTCAGAGA (SEQ ID NO: 332) 205 WO 2013/102674 PCT/EP2013/050126 Table 22.4: Total MABO1 antibody expression levels from fermentation cultures of RNAi strains and control strains. Protein G purified immunoglobulins. Tctal mAB T89 M507 +! T86 M507 TT113 MG65 T114 M66 T115 M6G7 jmgIL) SBTI day 6 581 987 day7 719 1415 485 436 1217 day8 890 1695 744 58 1471 day9 825 1908 945 696 1684 day1O 1082 1863 102 183 day11 1094 1769 Table 22.5: Dry weight measurements from shake flask culture mycelium. Two flasks were grown for each transformant and control strain. The strains are expressing RNAi directed at reducing the slp2 expression. Dry weight Day3 Day5 Day6 Day7 grams/20 grams/20 ml grams/20 grams/20 ml ml ml 217.12E 0,015 0,035 0,042 0,047 217.12E 0,022 0,035 0,049 0,047 218.25F 0,031 0,048 0,052 0,059 218.25F 0,038 0,046 0,051 0,056 218.67A 0,027 0,043 0,052 0,061 218.67A 0,024 0,046 0,051 0,059 263.110F 0,032 0,042 0,047 0,056 263.11OF 0,025 0,049 0,043 263.124C 0,002 0,009 0,020 0,020 263.124C 0,006 0,005 0,016 0,022 M507 0,038 0,049 0,060 0,063 M507 0,039 0,053 0,066 Table 22.6: Down regulation of slp2 expression in strains containing RNAi constructs Fold downregulation of slp2 217.12E no change 218.25F -1,8 218.67A -1,2 263.11OF -2,5 263.124C -36,3 206 WO 2013/102674 PCT/EP2013/050126 Table 22.7: Down regulation of slp2, slp3, slp5, and slp6 expression in strains with RNAi constructs. Fold downregulation of slp genes slp2 slp3 slp5 slp6 no no 218.25F -1,6 -1,8 change change no 263.124C -31,1 -6,0 change -2,3 Table 22.8: FTR104 cultivations were grown in TrMM plus 20 g/L yeast extract, 40 g/L cellulose, 80 g/L cellobiose, and 40 g/L sorbose at pH 5.5. The temperature was shifted from 28'C to 22'C after 48 hours. The total antibody titers are expressed in g/L. Day M507 M646 M665 M666 M667 Total Ab g/L g/L g/L g/L g/L 3 1,4 0,7 1,5 1,5 1,5 4 2,6 1,3 2,6 2,8 2,8 5 3,1 1,8 3,4 3,5 3,6 6 2,2 2,0 2,7 2,8 3,8 Table 22.9: Protease activity measurements of fermentation supernatants from strains with RNAi and control strains. Total protease activity at pH 5.5 with casein substrate. Protease activity Fluorescent units T89-M507 + T115 Day T86-M507 SBTI T113-M665 T114-M666 M667 1 0,7 0,2 1,3 -0,6 1,1 2 2,1 1,1 -1,1 -0,8 1,4 3 16,7 23,4 1,1 6,6 17,5 4 18,7 18,7 8,6 15,0 17,5 5 19,4 18,1 12,7 19,0 19,0 6 19,7 21,7 10,6 19,3 16,9 7 19,5 17,3 10,5 21,3 15,8 8 17,6 14,3 10,4 21,9 13,5 9 19,9 14,9 10,8 21,4 11,8 10 21,6 17,3 13,9 21,8 10,3 11 23,8 20,2 1 207 WO 2013/102674 PCT/EP2013/050126 EXAMPLE 23 - GENERATION OF ANTIBODY FRAGMENT EXPRESSING TRICHODERMA REESEI STRAINS [00577] Seven Trichoderma reesei strains were generated to express antibody fragments (Fabs, multimeric single domain antibodies (sd-Ab's) and scFVs) form different protease deletion backgrounds as listed in Table 23. The architecture of the genetic expression cassettes applied for this purpose was based on the regulatory elements (promoter and terminator) of the cellobiohydrolase I (cbhl) gene. The catalytic domain of the CBHI protein was modified to remove intron sequences and used as fusion partner to enhance antibody fragment expression and secretion. A recognition motif for the Kex2 protease was inserted in between the fusion partners to promoter co-secretory release of the antibody fragments from the CBHI carrier protein. The expression cassettes were flanked by homologous regions to allow targeted integration to the Trichoderma reesei cbh1 locus. The entire construct was stored in a cloning vector. [00578] In order to prepare the flanked expression cassettes for transformation the corresponding fragments were released from their respective vector backbones by PmeI restriction digestion and purified using the illustra GFX PCR DNA and Gel Band Purification Kit (GE Healthcare). [00579] As listed in Table 23, T. reesei protease deletion strains were transformed with the purified expression cassettes using PEG-mediated protoplast transformation. The transformants were selected for Hygromycin B resistance or acetamidase prototrophy by plating them onto medium containing Hygromycin B as a selective agent or acetamide as the sole nitrogen source, respectively. Up to 48 transformants each were screened by PCR for homologous integration of the expression cassette to the cbh1 locus using a forward primer outside the 5' flanking region fragment of the construct and the reverse primer inside the modified CBHI catalytic domain (5' integration) as well as a forward primer inside the Hygromycin B or acetamidase selection marker, respectively, and a reverse primer outside the 3' flanking region fragment (3' integration). From each transformation, five to seven independent transformants, for which the PCR screening proved correct integration of the construct to the cbh1 locus, were selected for single spore purification to obtain uninuclear clones. Proper integration of the disruption cassette 208 WO 2013/102674 PCT/EP2013/050126 was reconfirmed by PCR using the same primer combinations as described above and the absence of the parental CBHI locus was verified by using a primer combination targeted to the cbh1 open reading frame. Correct integration of the disruption cassette was additionally verified for all clones applying Southern hybridization. Genomic DNA of the uninuclear clones as well as the parental strain was independently digested with two different restriction enzyme combinations and probed against the 5' and 3' flanks of the cbh1 gene to confirm modification of the cbh1 locus as expected. Expression and titer analysis of antibody fragments (Fabs, single domain antibodies and scFVs) [00580] Expression of antibody fragments was facilitated by the cellobiohydrolase I promoter. Strains were grown in batch fermentations for 7 days, in media containing 2% yeast extract, 4% cellulose, 8% cellobiose, 4% sorbose, 5g/L KH 2
PO
4 , and 5g/L (NH 4
)
2
SO
4 . Culture pH was controlled at pH 5.5 (adjusted with NH 4 0H) and temperature was constantly kept at 28 0 C. Fermentations were carried out in 4 parallel 2 L glass vessel reactors (DASGIP) with a culture volume of 1 L. Culture supernatant samples were taken during the course of the runs and stored at -20 'C. Samples were collected daily from the whole course of these cultivations, and production levels were analyzed by affinity liquid chromatography for all molecules. For each antibody fragment the maximum titer, strain ID and protease deletion background is indicated in Table 23. Table 23: Expression levels of various antibody fragments FAb1 3.8 TR090 M307 4 ~5% FAb2 2.8 TR102 M400 6 ~5% FAb3 2.6 TR104 M400 6 nd sdAb-1 1.9 TR066 M307 4 nd sdAb-2 1.2 TR101 M400 6 ~45% scFV1-His 2.5 TR112 M400 6 nd scFV2 2.5 TR111 M400 6 nd 209 WO 2013/102674 PCT/EP2013/050126 *provided percentages are approximated (-) or not determined (nd) Titer determinations Mabs and sdAb [00581] Mab and sdAb concentrations were quantified by HPLC - Protein A chromatography, which is based on affinity chromatography with UV detection. The Fc-domain of human immunoglobulines of the G-class (subtype-class: IgGI, IgG2, IgG4, except IgG3) binds specifically to protein A which is covalently linked to the stationary phase. The binding affinity of protein A to the Fc-domain is pH dependent. After binding at pH 7.5 the monoclonal antibody was eluted under acidic conditions at pH 2.0 and detected at 280 nm. Fab [00582] Fab concentrations were quantified by HPLC - anti-Lambda chromatography, which is based on affinity chromatography with UV detection. The lambda chain of human Fab fragments binds specifically to a camelid-derived anti-lambda ligand which is covalently linked to the stationary phase. After binding at pH 7.5, the monoclonal antibody was eluted under acidic conditions at pH 1.4 and detected at 280 nm. scFV2 [00583] scFV2 concentrations were quantified by HiTrap Protein L purification using an Akta avant system and subsequent UV detection. The kappa light chain part of scFV2 binds specifically to the Protein L ligand which is covalently linked to the stationary phase. After binding at pH 7.2, scFV2 was eluted under acidic conditions with 0.1 mM HCl and detected at 280 nm. scFV1-His [00584] scFV 1-His concentrations were quantified by HisTrap HP purification using an Akta avant system and subsequent UV detection. The histidine tag of the protein binds 210 WO 2013/102674 PCT/EP2013/050126 specifically to Ni sepharose. After binding, the protein was eluted using 500 mM Imidazol and detected at 280 nm. 211
权利要求:
Claims (30)
[1] 1. A filamentous fungal cell comprising at least three endogenous proteases having reduced activity, and a recombinant polynucleotide encoding a heterologous polypeptide, wherein the polypeptide is produced at a level of at least two-fold higher than the production level of the polypeptide in a corresponding parental filamentous fungal cell in which the proteases do not have the reduced activity.
[2] 2. The filamentous fungal cell of Claim 1, with the proviso that, when the cell is an Aspergillus cell, the total protease activity is reduced to 50% or less of the total protease activity of the corresponding parental Aspergillus cell in which the proteases do not have reduced activity.
[3] 3. The filamentous fungal cell of claim 1 or 2, wherein the total protease activity is reduced to 49% or less, preferably 31% or less, of the total protease activity of the corresponding parental filamentous fungal cell in which the proteases do not have the reduced activity.
[4] 4. The filamentous fungal cell of any one of claims 1-3, wherein at least three genes encoding endogenous proteases each comprise a mutation that reduces or eliminates the corresponding protease activity.
[5] 5. The filamentous fungal cell of any one of claims 1-4, wherein at least four genes encoding endogenous proteases each comprise a mutation that reduces or eliminates the corresponding protease activity.
[6] 6. The filamentous fungal cell of any preceding claim, wherein the fungal cell is a Trichoderma fungal cell, a Myceliophthora fungal cell, an Aspergillus fungal cell, a Neurospora fungal cell, a Penicillium cell, or a Chrysosporium fungal cell.
[7] 7. The filamentous fungal cell of any preceding claim, wherein the fungal cell is Trichoderma reesei.
[8] 8. The filamentous fungal cell of Claim 6 or 7, wherein said cell is wild type for pep4 protease. 212 WO 2013/102674 PCT/EP2013/050126
[9] 9. The filamentous fungal cell of claim 6, 7 or 8, wherein the cell has reduced or no protease activity in at least the following three proteases: either pep1, tspl and slpI or gap1, slp1, and pep1.
[10] 10. The filamentous fungal cell of claims 6 or 7, wherein the cell has reduced or no detectable protease activity in at least three or four proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, pep8, pep11, pep12, tsp1, slp1, slp2, slp3, slp7, gap1, and gap2.
[11] 11. The filamentous fungal cell of claim 10, wherein each of the genes encoding the three or four proteases with reduced or no detectable protease activity comprises a mutation that reduces or eliminates the corresponding protease activity.
[12] 12. The filamentous fungal cell of claim 6 or 7, wherein the cell has reduced or no protease activity in at least eight proteases, each of the genes encoding the eight proteases comprises a mutation that reduces or eliminates the corresponding protease activity, and the eight proteases are pepi, tspl, slpl, gapi, gap2, pep4, pep3, and pep5.
[13] 13. The filamentous fungal cell of claim 6 or 7, wherein the cell comprises three to six proteases having reduced or no detectable activity, and each of the three to six proteases are selected from the group consisting of pep1, pep2, pep3, pep4, pep5, tspl, slpl, slp2, slp3, gapi, and gap2.
[14] 14. The filamentous fungal cell of any one of Claims 6-13, wherein the cell comprises a gene encoding an additional protease which comprises a mutation that reduces the corresponding protease activity, and the additional protease is selected from the group consisting of pep7, pep8, pep11, pep12, tpp1, gap2, slp3, slp5, slp6, slp7, and slp8.
[15] 15. The filamentous fungal cell of any preceding claim, wherein the heterologous polypeptide is a mammalian polypeptide.
[16] 16. The filamentous fungal cell of claim 15, wherein the mammalian polypeptide is glycosylated. 213 WO 2013/102674 PCT/EP2013/050126
[17] 17. The filamentous fungal cell of claim 15, wherein the mammalian polypeptide is selected from the group consisting of an antibody and their antigen-binding fragments, a growth factor, an interferon, a cytokine, and an interleukin.
[18] 18. The filamentous fungal cell of claim 15, wherein the mammalian polypeptide is selected from the group consisting of insulin-like growth factor 1 (IGF1), human growth hormone (hGH), and interferon alpha 2b (IFNa2b).
[19] 19. The filamentous fungal cell of any preceding claim, wherein the fungal cell further comprises ALG3 having reduced activity.
[20] 20. The filamentous fungal cell of claim 19, wherein the gene encoding ALG3 comprises a mutation that reduces or eliminates the corresponding activity.
[21] 21. The filamentous fungal cell of any one of claims 1-20, wherein the fungal cell further comprises a polynucleotide encoding an a-1,2-mannosidase.
[22] 22. The filamentous fungal cell of any preceding claim, further comprising an N-acetylglucosaminyltransferase I catalytic domain, and, optionally, an N-acetylglucosaminyltransferase II catalytic domain.
[23] 23. The filamentous fungal cell of claim 22, further comprising a first polynucleotide encoding the N-acetylglucosaminyltransferase I catalytic domain and, optionally, a second polynucleotide encoding the N-acetylglucosaminyltransferase II catalytic domain.
[24] 24. The filamentous fungal cell of any preceding claim, further comprising a polynucleotide encoding a mannosidase II and/or a galactosyl transferase.
[25] 25. A method of improving stability of a polypeptide, comprising a) providing the filamentous fungal cell of any preceding claim, and b) culturing the cell such that the heterologous polypeptide is expressed, 214 WO 2013/102674 PCT/EP2013/050126 wherein the heterologous polypeptide exhibits increased stability compared to the heterologous polypeptide produced in a corresponding parental filamentous fungal cell in which the proteases do not have reduced activity.
[26] 26. A method of making a heterologous polypeptide, comprising a) providing the filamentous fungal cell of any of claims 1-24, b) culturing the cell such that the heterologous polypeptide is expressed, and c) purifying the heterologous polypeptide.
[27] 27. The method of claim 25 or claim 26, wherein the filamentous fungal cell further comprises a carrier protein.
[28] 28. The method of claim 27, wherein the carrier protein is CBH1.
[29] 29. The method of any one of claims 26-28 wherein the culturing is in a medium comprising a protease inhibitor.
[30] 30. The method of any one of claims 26-29 wherein the culturing is in a medium comprising one or two protease inhibitors selected from SBT1 and chymostatin. 215
类似技术:
公开号 | 公开日 | 专利标题
US10731168B2|2020-08-04|Protease deficient filamentous fungal cells and methods of use thereof
US10544440B2|2020-01-28|Multiple protease deficient filamentous fungal cells and methods of use thereof
AU2015293949B2|2019-07-25|Production of glycoproteins with mammalian-like N-glycans in filamentous fungi
US20180215797A1|2018-08-02|Regulatory Protein Deficient Trichoderma Cells and Methods of Use Thereof
TN et al.0|gk kkk kMMkkk S kkSkk BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM
同族专利:
公开号 | 公开日
MX355226B|2018-03-23|
DK2800809T3|2018-05-22|
WO2013102674A2|2013-07-11|
US11180767B2|2021-11-23|
JP2018038419A|2018-03-15|
AU2013207165B2|2018-10-04|
KR20140114860A|2014-09-29|
WO2013102674A3|2013-11-14|
CN107868758A|2018-04-03|
US10731168B2|2020-08-04|
RU2645252C2|2018-02-19|
US10240159B2|2019-03-26|
EP3358000A2|2018-08-08|
RU2014132178A|2016-02-20|
US20210139922A1|2021-05-13|
US20140370546A1|2014-12-18|
EP2800809A2|2014-11-12|
BR112014016587A2|2020-10-27|
IL233052D0|2014-07-31|
JP2015512611A|2015-04-30|
MX2014008272A|2015-02-24|
SG11201403818XA|2014-08-28|
CA2861697A1|2013-07-11|
US20190233831A1|2019-08-01|
CN104245919A|2014-12-24|
EP2800809B1|2018-03-07|
JP6245528B2|2017-12-13|
US20170275634A1|2017-09-28|
US9567596B2|2017-02-14|
EP3358000A3|2018-12-19|
CN104245919B|2017-07-14|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题
US4500707A|1980-02-29|1985-02-19|University Patents, Inc.|Nucleosides useful in the preparation of polynucleotides|
US4475196A|1981-03-06|1984-10-02|Zor Clair G|Instrument for locating faults in aircraft passenger reading light and attendant call control system|
US4447233A|1981-04-10|1984-05-08|Parker-Hannifin Corporation|Medication infusion pump|
US4439196A|1982-03-18|1984-03-27|Merck & Co., Inc.|Osmotic drug delivery system|
US4447224A|1982-09-20|1984-05-08|Infusaid Corporation|Variable flow implantable infusion apparatus|
US4487603A|1982-11-26|1984-12-11|Cordis Corporation|Implantable microinfusion pump system|
US4816567A|1983-04-08|1989-03-28|Genentech, Inc.|Recombinant immunoglobin preparations|
US4486194A|1983-06-08|1984-12-04|James Ferrara|Therapeutic device for administering medicaments through the skin|
US4758512A|1984-03-06|1988-07-19|President And Fellows Of Harvard College|Hosts and methods for producing recombinant products in high yields|
US4596556A|1985-03-25|1986-06-24|Bioject, Inc.|Hypodermic injection apparatus|
US4683195B1|1986-01-30|1990-11-27|Cetus Corp||
US4790824A|1987-06-19|1988-12-13|Bioject, Inc.|Non-invasive hypodermic injection device|
US4941880A|1987-06-19|1990-07-17|Bioject, Inc.|Pre-filled ampule and non-invasive hypodermic injection device assembly|
US5700637A|1988-05-03|1997-12-23|Isis Innovation Limited|Apparatus and method for analyzing polynucleotide sequences and method of generating oligonucleotide arrays|
CA1333777C|1988-07-01|1995-01-03|Randy M. Berka|Aspartic proteinase deficient filamentous fungi|
GB8822228D0|1988-09-21|1988-10-26|Southern E M|Support-bound oligonucleotides|
US5064413A|1989-11-09|1991-11-12|Bioject, Inc.|Needleless hypodermic injection device|
US5312335A|1989-11-09|1994-05-17|Bioject Inc.|Needleless hypodermic injection device|
GB2276169A|1990-07-05|1994-09-21|Celltech Ltd|Antibodies specific for carcinoembryonic antigen|
US5846802A|1992-04-15|1998-12-08|Buxton; Frank|Fungal Protease|
CA2096289A1|1992-05-15|1993-11-16|Wouter Musters|Cloning and expression of dna encoding a ripening form of a polypeptide having rhamnogalacturonase activity|
US5383851A|1992-07-24|1995-01-24|Bioject Inc.|Needleless hypodermic injection device|
DK52393D0|1993-05-05|1993-05-05|Novo Nordisk As||
US5674728A|1993-11-03|1997-10-07|Novartis Corporation|Aspergillus niger vacuolar aspartyl protease|
WO1995035385A1|1994-06-17|1995-12-28|Novo Nordisk A/S|A FUNGUS WHEREIN THE areA GENE HAS BEEN MODIFIED AND AN areA GENE FROM ASPERGILLUS ORYZAE|
US6060305A|1994-06-30|2000-05-09|Novo Nordisk Biotech, Inc.|Non-toxic, non-toxigenic, non-pathogenic Fusarium expression system|
AU3802595A|1994-11-08|1996-05-31|Novo Nordisk A/S|Tripeptidyl aminopeptidase|
JP3974171B2|1995-03-20|2007-09-12|ノボザイムスアクティーゼルスカブ|Host cell for detecting reduced levels of metalloprotease and method of using the cell for protein production|
WO1997012045A1|1995-09-27|1997-04-03|Chiron Corporation|Method of making a protease deficient host|
AU1092897A|1995-12-15|1997-07-14|Novo Nordisk A/S|A funguns wherein the area, pepc and/or pepe genes have been inactivated|
US5776730A|1995-12-15|1998-07-07|University Of Hawaii|Neurospora hosts for the production of recombinant proteins, and methods for producing same|
AT294233T|1996-01-19|2005-05-15|Novozymes Biotech Inc|MORPHOLOGICAL MUTANTS OF FILAMENTOUS MUSHROOMS|
AT317005T|1996-03-27|2006-02-15|Novozymes As|ALKALINE PHOSPHATASE DEFICIENT, FILAMENTOUS MUSHROOMS|
JP2000511429A|1996-06-05|2000-09-05|ギストブロカデスベスローテンフェンノートシャップ|Fungal metalloprotease gene|
AT313620T|1996-09-19|2006-01-15|Novozymes As|HOST CELLS AND METHODS FOR PRODUCING PROTEINS|
US7883872B2|1996-10-10|2011-02-08|Dyadic International , Inc.|Construction of highly efficient cellulase compositions for enzymatic hydrolysis of cellulose|
US6806062B1|1998-10-05|2004-10-19|Novozymes A/S|Fungal transcriptional activator useful in methods for producing polypeptides|
AU2755300A|1999-02-02|2000-08-25|Novozymes Biotech, Inc.|Methods for producing polypeptides in fungal cells|
WO2000050576A1|1999-02-22|2000-08-31|Novozymes A/S|Oxaloacetate hydrolase deficient fungal host cells|
CN1380905A|2000-04-13|2002-11-20|马克·阿龙·埃马尔法尔布|High-throughput screening of expressed DNA libraries in filamentous fungi|
KR20020026456A|2000-04-13|2002-04-10|에말파브 마크 아론|High-throughput screening of expressed dna libraries in filamentous fungi|
JP2003526374A|2000-03-14|2003-09-09|ノボザイムスアクティーゼルスカブ|Fungal transcriptional activators useful in polypeptide production methods|
AT266087T|2000-12-07|2004-05-15|Dsm Ip Assets Bv|METHOD FOR PREVENTING OR REDUCING THE TURBIDITY IN BEVERAGES|
AU2002308306B2|2001-02-23|2007-03-01|Dsm Ip Assets B.V.|Genes encoding proteolytic enzymes from aspargilli|
US7404977B2|2001-12-21|2008-07-29|Dsm Ip Assets B.V.|Rennets|
JP2006512891A|2002-04-18|2006-04-20|ジェネンコー・インターナショナル・インク|Production of functional antibodies in filamentous fungi|
WO2004067709A2|2003-01-17|2004-08-12|Elitra Pharmaceuticals, Inc.|Identification of essential genes of aspergillus fumigatus and methods of use|
DE602004022929D1|2003-03-31|2009-10-15|Novozymes Inc|PROCESS FOR THE PRODUCTION OF BIOLOGICAL SUBSTANCES I|
WO2005056772A1|2003-12-09|2005-06-23|Novozymes Inc.|Methods for eliminating or reducing the expression of genes in filamentous fungal strains|
GB0405659D0|2004-03-12|2004-04-21|Horticulture Res Internat|Altered expression in filamentous fungi|
EP1756145B1|2004-06-16|2014-06-25|DSM IP Assets B.V.|Production of polypeptides by improved secretion|
CN101094919B|2004-10-12|2014-09-03|帝斯曼知识产权资产管理有限公司|Fungal transcriptional activators useful in methods for producing a polypeptide|
GB0424940D0|2004-11-11|2004-12-15|Danisco|Transcription factors|
CN101094918B|2004-12-30|2014-05-14|金克克国际有限公司|Acid fungal proteases|
EP2314667B1|2005-04-12|2016-11-23|Danisco US Inc.|Gene inactivated mutants with altered protein production|
DE602006018634D1|2005-08-03|2011-01-13|Asahi Glass Co Ltd|Transformed Yeast Cells AND METHOD FOR PRODUCING FOREIGN PROTEIN|
US7858360B2|2005-10-17|2010-12-28|Novozymes A/S|Use of fungal mutants for expression of antibodies|
CA2630455A1|2005-11-29|2007-06-07|Dsm Ip Assets B.V.|Dna binding site of a transcriptional activator useful in gene expression|
EP2423315B1|2006-06-29|2015-01-07|DSM IP Assets B.V.|A method for achieving improved polypeptide expression|
WO2008027472A2|2006-08-29|2008-03-06|Danisco Us, Inc., Genencor Division|Compositions and methods for improved protein production|
WO2008053018A2|2006-11-02|2008-05-08|Dsm Ip Assets B.V.|Improved production of secreted proteins by filamentous fungi|
US9862956B2|2006-12-10|2018-01-09|Danisco Us Inc.|Expression and high-throughput screening of complex expressed DNA libraries in filamentous fungi|
WO2008073914A2|2006-12-10|2008-06-19|Dyadic International Inc.|Expression and high-throughput screening of complex expressed dna libraries in filamentous fungi|
JP5951924B2|2006-12-21|2016-07-13|ノボザイムス,インコーポレイティド|Method for reducing or eliminating gene expression in filamentous strains by secondary RNA interference|
EP2508612B1|2007-04-03|2017-11-29|Oxyrane UK Limited|Glycosylation of molecules|
DK2152892T3|2007-05-21|2013-07-22|Danisco Us Inc Genencor Div|Method of introducing nucleic acids into fungal cells|
MX2010004325A|2007-11-01|2010-05-20|Danisco Us Inc|Signal sequences and co-expressed chaperones for improving protein production in a host cell.|
EP2220110A1|2007-12-06|2010-08-25|Novozymes A/S|Fungal pepc inhibitor|
US20090253173A1|2008-04-08|2009-10-08|Danisco Us Inc., Genencor Division|Filamentous fungi with inactivated protease genes for altered protein production|
US20110111977A1|2008-07-03|2011-05-12|Pfenex, Inc.|High throughput screening method and use thereof to identify a production platform for a multifunctional binding protein|
WO2010014574A2|2008-07-29|2010-02-04|Danisco Us Inc.|Increased production of aspartic proteases in filamentous fungal cells|
CN102227502B|2008-09-30|2016-01-13|诺维信股份有限公司|The method of polypeptide is produced in the enzyme defect mutant of empiecement sickle spore|
WO2010059626A1|2008-11-18|2010-05-27|Danisco Us Inc.|Filamentous fungi with impaired ptrb activity for altered protein production|
US9493759B2|2008-12-12|2016-11-15|Novozymes, Inc.|Polypeptides having aspartic endopeptidase activity and polynucleotides encoding same|
EP2408910B1|2009-03-16|2018-04-25|Danisco US Inc.|Chrysosporium lucknowense protein production system|
JP2013507921A|2009-10-16|2013-03-07|メルク・シャープ・エンド・ドーム・コーポレイション|Process for the production in Pichia pastoris of proteins lacking detectable cross-linking activity against antibodies against host cell antigens|
US20120213728A1|2009-10-30|2012-08-23|Merck|Granulocyte-colony stimulating factor produced in glycoengineered pichia pastoris|
KR20140015137A|2009-10-30|2014-02-06|머크 샤프 앤드 돔 코포레이션|Methods for the production of recombinant proteins with improved secretion efficiencies|
EP2494030A4|2009-10-30|2013-03-27|Merck Sharp & Dohme|Method for producing therapeutic proteins in pichia pastoris lacking dipeptidyl aminopeptidase activity|
US20130053550A1|2009-11-19|2013-02-28|Oxyrane Uk Limited|Yeast strains producing mammalian-like complex n-glycans|
BR122018077153B1|2009-12-18|2020-10-27|Novozymes, Inc|mutant of a parental trichoderma reesei strain, and, methods to produce a polypeptide of interest and to obtain a mutant of a parental trichoderma reesei strain|
CA2784944A1|2009-12-21|2011-06-30|Centre Hospitalier Universitaire Vaudois|Synergic action of a prolyl protease and tripeptidyl proteases|
CN102858949B|2010-02-24|2016-07-06|默沙东公司|For increasing the method that the N-glycosylation site on the therapeutic glycoprotein produced in pichia pastoris occupies|
WO2012021883A2|2010-08-13|2012-02-16|Dyadic International, Inc.|Novel fungal enzymes|
WO2012024662A2|2010-08-20|2012-02-23|Codexis, Inc.|Expression constructs comprising fungal promoters|
WO2012048334A2|2010-10-08|2012-04-12|Dyadic International Inc.|Novel fungal proteases|
BR112013010813A2|2010-11-02|2016-07-12|Codexis Inc|fungal cells, mixed enzymes, methods for glucose generation and fermentation medium.|
CN109136114A|2011-08-24|2019-01-04|诺维信股份有限公司|The method of a variety of recombinant polypeptides is generated in filamentous fungal host cell|
WO2013048661A1|2011-09-30|2013-04-04|Codexis, Inc.|Fungal proteases|
US9567596B2|2012-01-05|2017-02-14|Glykos Finland Oy|Protease deficient filamentous fungal cells and methods of use thereof|
US20150337279A1|2012-11-20|2015-11-26|Codexis, Inc.|Recombinant fungal polypeptides|US9567596B2|2012-01-05|2017-02-14|Glykos Finland Oy|Protease deficient filamentous fungal cells and methods of use thereof|
EP2971030B8|2013-03-14|2018-12-05|Glycobia, Inc|Oligosaccharide compositions, glycoproteins and methods to produce the same in prokaryotes|
US10435731B2|2013-07-10|2019-10-08|Glykos Finland Oy|Multiple proteases deficient filamentous fungal cells and methods of use thereof|
SG11201700446XA|2014-07-21|2017-02-27|Glykos Finland Oy|Production of glycoproteins with mammalian-like n-glycans in filamentous fungi|
WO2016065238A1|2014-10-24|2016-04-28|Danisco Us Inc.|Method for producing alcohol by use of a tripeptidyl peptidase|
RU2741080C2|2014-10-24|2021-01-22|ДюПон НЬЮТРИШН БАЙОСАЙЕНСИЗ АпС|Tripeptidyl peptidases capable of acting on proline linking and use thereof|
DK3259364T3|2015-02-20|2020-09-07|Roal Oy|Methods for controlling protease production|
CN106190874B|2015-05-06|2020-06-26|中国科学院天津工业生物技术研究所|Method for enhancing production of filamentous fungal protein|
CN104990881A|2015-07-09|2015-10-21|辽宁省农业科学院蔬菜研究所|Method for quickly detecting vigor of morchella esculenta L. hyphae|
CN108603187A|2015-11-24|2018-09-28|诺维信公司|Polypeptide with proteinase activity and encode their polynucleotides|
WO2017115005A1|2015-12-29|2017-07-06|Teknologian Tutkimuskeskus Vtt Oy|Production of fusion proteins in trichoderma|
US10876103B2|2016-10-04|2020-12-29|Danisco Us Inc|Protein production in filamentous fungal cells in the absence of inducing substrates|
CN108588060B|2017-03-07|2020-12-01|武汉康复得生物科技股份有限公司|Recombinant oxalate decarboxylase expressed by filamentous fungus host cell|
WO2019027364A1|2017-07-31|2019-02-07|Biopetrolia Ab|Fungal cell with improved protein production capacity|
CN111148841A|2017-08-30|2020-05-12|诺维信公司|Combined use of endoproteases of the M35 family and exoproteases of the S53 family in starch fermentation|
EP3696274A4|2017-10-10|2021-07-28|Ajinomoto Co., Inc.|Method for manufacturing protein|
WO2019175477A1|2018-03-12|2019-09-19|Teknologian Tutkimuskeskus Vtt Oy|A subunit vaccine against porcine post-weaning diarrhoea|
US10787656B2|2018-05-04|2020-09-29|Fomia BioSolutions, Inc.|Variant alkaline protease enzyme compositions and methods|
WO2020045472A1|2018-08-29|2020-03-05|東レ株式会社|Mutant strain of trichoderma reesei and method for producing protein using same|
CN111088244A|2018-10-23|2020-05-01|中国科学院天津工业生物技术研究所|Application of protease gene in promotion of cellulase production and complex nitrogen source utilization|
WO2021007630A1|2019-07-16|2021-01-21|Centro Nacional De Pesquisa Em Energia E Materiais|Modified trichoderma fungal strain for the production of an enzyme cocktail|
CN110724644A|2019-12-05|2020-01-24|西北农林科技大学|Trichoderma reesei engineering bacterium for producing recombinant human proinsulin and application thereof|
WO2022023583A1|2020-07-31|2022-02-03|Biotalys NV|Expression host|
法律状态:
2018-03-08| PC1| Assignment before grant (sect. 113)|Owner name: GLYKOS FINLAND OY Free format text: FORMER APPLICANT(S): GLYKOS FINLAND OY; NOVARTIS AG |
2019-01-31| FGA| Letters patent sealed or granted (standard patent)|
2021-07-29| MK14| Patent ceased section 143(a) (annual fees not paid) or expired|
优先权:
申请号 | 申请日 | 专利标题
US201261583559P| true| 2012-01-05|2012-01-05||
US61/583,559||2012-01-05||
PCT/EP2013/050126|WO2013102674A2|2012-01-05|2013-01-04|Protease deficient filamentous fungal cells and methods of use thereof|
[返回顶部]