![]() Cell-penetrating peptides
专利摘要:
The invention relates to a cell-penetrating peptide, optionally linked to a pro-apoptotic peptide, useful as pro-apoptotic agents, for inhibition of 公开号:AU2012360845A1 申请号:U2012360845 申请日:2012-12-27 公开日:2014-07-31 发明作者:Jeronimo Bravo Sicilia;Didier Decaudin;Jesus Maria FOMINAYA GUTIERREZ;Fariba Nemati;Angelita Rebollo Garcia 申请人:Universite Pierre et Marie Curie Paris 6;Institut Curie; IPC主号:C07K14-47
专利说明:
WO 2013/098337 PCT/EP2012/076968 1 CELL-PENETRATING PEPTIDES The invention relates to shuttle peptides that penetrate the cell membrane. 5 Background of the invention: Apoptosis is a genetically programmed cell death and its deregulation is associated among other pathologies, with cancer. While apoptosis is known to rely on the Bcl-2 family members and caspases, recent data suggested that two major families of serine/threonine phosphatases, PP1 and PP2A, are key actors involved in cell life or cell death decision. 10 The Ser/Thre phosphatase PP2A has been implicated in both, induction and prevention of apoptosis, pointing to a complex interplay of phosphatase actions. Several phosphatases have recently become attractive targets for the treatment of a variety of diseases, including cancers. However, the only clinical drugs targeting a phosphatase are the immunosuppressive cyclosporine A and FK506. 15 Cell penetrating peptides (CPP) are molecules which can translocate into cells without causing membrane damage, leading to their proposed use as vectors for delivering therapeutic cargo. Several CPP have been identified such as Tat, antennapedia, or SHV1 VP22. These peptides can cross the cell membrane and reach the cytoplasm and/or the nucleus. Penetrating peptides interacting with PP1/PP2A 20 proteins were designed. This approach, named "Drug Phosphatase Technology" (DPT), was described in Guergnon et al, 2006 and International patent applications W02003/011898 and W02004/011595. A pro-apoptotic peptide, called DPT-C9h, that specifically deregulates the interaction between caspase-9 and PP2A, used this penetrating sequence (international patent application W02010/112471). 25 However this peptide shows a short half-life, which is a real draw-back for clinical uses. Summary of the invention: The present mutated peptides overcome this problem since they are not digested by 30 human serum proteases. This new property makes it possible to reduce the dose of peptide injected as well as the schedule of administration. The invention provides a peptide comprising the following amino acid sequence (1): X 1 rKKKIK-Y-El-X 2 X 3 (I) (SEQ ID NO:1) 35 wherein X 1 is vacant, is a lysine residue, or valine-lysine; WO 2013/098337 PCT/EP2012/076968 2 X 2 is vacant, is a lysine residue, or lysine-isoleucine; X 3 is vacant or is an amino acid sequence of 1 to 4 amino acids; and L is an amino acid residue that is different from arginine, or a proteolysis-resistant peptide deriving from sequence (1) by one or more chemical 5 modifications, or a substantially homologous peptide deriving from sequence (1) by one or more conservative substitutions. The invention further provides a vector comprising said peptide, as a cell penetrating peptide, coupled to a molecule of interest. 10 The invention further provides a chimeric peptide construct, comprising said peptide, as a cell penetrating peptide, fused to a pro-apoptotic peptide, wherein the penetrating peptide is preferably fused at the N-terminus of the pro-apoptotic peptide. Another aspect of the invention is a nucleic acid comprising a sequence coding for 15 the cell penetrating peptide or for the chimeric peptide construct. Still another aspect of the invention is a vector comprising a nucleic acid comprising (i) a nucleotide sequence coding for the cell penetrating peptide coupled to (ii) a nucleotide sequence of interest, for use in gene therapy or gene transfer in vivo or ex vivo. 20 Using the chimeric peptide construct, or of a nucleic acid encoding said chimeric peptide construct, for inhibition of cell proliferation in vitro, is further encompassed. A further subject of the invention is a pharmaceutical composition comprising said 25 vector or a chimeric peptide as herein described, in association with a pharmaceutically acceptable carrier. The invention further relates to the use of the chimeric peptides or the pharmaceutical composition according to the invention for treating hyperproliferative diseases or parasitic 30 diseases. Detailed descriptio o te nvnton The inventors have worked to improve stability of the peptides disclosed in W02010/112471, in particular peptide DPT-C9h that is subjected to degradation by 35 proteases. This peptide corresponds to a penetrating peptide associated to the sequence WO 2013/098337 PCT/EP2012/076968 3 of the binding site of caspase-9 to PP2A. This peptide induces apoptosis in human cell lines. In addition, it has a specific apoptotic effect only in tumoral B cells isolated from chronic lymphocityc leukemia patients without effect on healthy cells. In addition, the peptide induces important reduction in the size of tumor when injected in mice bearing 5 human breast cancer xenograft. DPT-C9 consists of sequence VKKKKIKREIKI-YVETLDDIFEQWAHSEDL (SEQ ID NO:6), where VKKKKIKREIKI (SEQ ID NO:7) is the penetrating peptide. The inventors have shown that a mutation in the penetrating peptide dramatically increases the stability of the whole peptide, while maintaining its properties, in particular 10 its ability to induce apoptosis. According to the invention, a mutation of the arginine residue in the penetrating peptide prevents cleavage from proteases. The inventors have thus designed peptides comprising the following amino acid sequence (1): 15 X 1 -KKKIK-Y-El-X 2 -X 3 (1) (SEQ ID NO:1) wherein X 1 is vacant, is a lysine residue, or valine-lysine; X 2 is vacant, is a lysine residue, or lysine-isoleucine; X 3 is vacant or is an amino acid sequence of 1 to 4 amino acids; and W is an amino acid residue that is different from arginine,. 20 In a preferred embodiment, W is A, K or N. Still preferably W is non-conservative with respect to arginine. In a preferred embodiment, W is thus an amino acid residue different from lysine, asparagine, or glutamine. Preferably W is alanine. In a preferred embodiment, 25 X 1 is valine-lysine; X 2 is lysine-isoleucine; and X 3 is vacant. The preferred peptide is VKKKKIKAEIKI (SEQ ID NO:2). 30 Another peptide is VKKKKIKKEIKI (SEQ ID NO:10). Still another peptide is VKKKKIKNEIKI (SEQ ID NO:11). Definitions : The term "patient" refers to a human or non human animal, preferably a mammal, 35 including male, female, adult and children in need of a treatment wherein a pro-apoptotic effect is desired. WO 2013/098337 PCT/EP2012/076968 4 As used herein, the term "treatment" or "therapy" includes curative and/or prophylactic treatment. More particularly, curative treatment refers to any of the alleviation, amelioration and/or elimination, reduction and/or stabilization (e.g., failure to progress to more advanced stages) of a symptom, as well as delay in progression of a symptom of a 5 particular disorder. Prophylactic treatment refers to any of: halting the onset, reducing the risk of development, reducing the incidence, delaying the onset, reducing the development, as well as increasing the time to onset of symptoms of a particular disorder. The term "penetrating peptide" or "cell-penetrating peptide" (or "CPP") or "shuttle 10 peptide", as used interchangeably, means that the peptide is able to translocate into cells without causing substantial membrane damage, and can be used as a vector of other molecules when linked to them. The terms refer to cationic cell penetrating peptides, also called transport peptides, carrier peptides, or peptide transduction domains. The CPP, as shown herein, have the capability of inducing cell penetration of a peptide fused to the 15 CPP within 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% of cells of a given cell culture population, including all integers in between, and allow macromolecular translocation within multiple tissues in vivo upon systemic administration. A cell-penetrating peptide may also refers to a peptide which, when brought into contact with a cell under appropriate conditions, passes from the external environment in the intracellular 20 environment, including the cytoplasm, organelles such as mitochondria, or the nucleus of the cell, in conditions significantly greater than passive diffusion. This property may be assessed by various methods known by the skilled person. Two amino acid sequences are "homologous", "substantially homologous" or "substantially similar" when one or more amino acid residues are replaced by a 25 biologically similar residue or when greater than 80 % of the amino acids are identical, or greater than about 90 %, preferably greater than about 95%, are similar (functionally identical). Preferably, the similar or homologous sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin) pileup program, or any of the programs known 30 in the art (BLAST, FASTA, etc.). Preferably, these homologous peptides do not include two cysteine residues, so that cyclization is prevented. The term "conservative substitution" as used herein denotes the replacement of an amino acid residue by another, without altering the overall conformation and function of the peptide, including, but not limited to, replacement of an amino acid with one having 35 similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, shape, hydrophobic, aromatic, and the like). Amino acids with similar properties are WO 2013/098337 PCT/EP2012/076968 5 well known in the art. For example, arginine, histidine and lysine are hydrophilic-basic amino acids and may be interchangeable. Similarly, isoleucine, a hydrophobic amino acid, may be replaced with leucine, methionine or valine. Neutral hydrophilic amino acids, which can be substituted for one another, include asparagine, glutamine, serine and 5 threonine. By "substituted" or "modified" the present invention includes those amino acids that have been altered or modified from naturally occurring amino acids. As such, it should be understood that in the context of the present invention, a conservative substitution is recognized in the art as a substitution of one amino acid for 10 another amino acid that has similar properties. Examples of conservative substitutions are set out in the Table 1 below: Table 1. Conservative Substitutions I SIDE CHAIN AMINO ACID CHARACTERISTIC Non-polar G A P I L V Polar-uncharged C S T M N Q Polar-charged D E K R Aromatic HFWY Other NQDE 15 Alternatively, conservative amino acids can be grouped as described in Lehninger, 1975, as set out in Table 2, immediately below. Table 2. Conservative Substitutions 1i WO 2013/098337 PCT/EP2012/076968 6 SIDE CHAIN CHARACTERISTIC AMINO ACID Non-polar (hydrophobic) A. Aliphatic: A L I V P B. Aromatic: F W C. Sulfur-containing: M D. Borderline: G Uncharged-polar A. Hydroxyl: STY B. Amides: N Q C. Sulfhydryl: C D. Borderline: G Positively Charged (Basic): K R H Negatively Charged (Acidic): D E As still another alternative, exemplary conservative substitutions are set out in Table 3, immediately below. 5 Table 3. Conservative Substitutions III WO 2013/098337 PCT/EP2012/076968 7 Original Residue Exemplary Substitution Ala (A) Val (V), Leu (L), Ile (I) Arg (R) Lys (K), Gin (Q), Asn (N) Asn (N) Gin (Q), His (H), Lys (K), Arg (R) Asp (D) Glu (E) Cys (C) Ser (S) Gln (Q) Asn (N) Giu (E) Asp (D) His (H) Asn (N), Gin (Q), Lys (K), Arg (R) Ile (I) Leu (L), Val (V), Met (M), Ala (A), Phe (F) Leu (L) IIe (I), Val (V), Met (M), Ala (A), Phe (F) Lys (K) Arg (R), Gln (Q), Asn (N) Met (M) Leu (L), Phe (F), Ile (I) Phe (F) Leu (L), Val (V), Ile (1), Ala (A) Pro (P) Gly (G) Ser (S) Thr (T) Thr (T) Ser (S) Trp (W) Tyr (T) Tyr (Y) Trp (W), Phe (F), Thr (T), Ser (S) Val (V) Ile (1), Leu (L), Met (M), Phe (F), Ala (A) Peptide preparation: Peptides described herein can be synthesized using standard synthetic methods 5 known to those skilled in the art., for example chemical synthesis or genetic recombination. In a preferred embodiment, peptides are obtained by stepwise condensation of amino acid residues, either by condensation of a preformed fragment already containing an amino acid sequence in appropriate order, or by condensation of several fragments previously prepared, while protecting the amino acid functional groups 10 except those involved in peptide bond during condensation. In particular, the peptides can be synthesized according to the method originally described by Merrifield. Examples of chemical synthesis technologies are solid phase synthesis and liquid phase synthesis. As a solid phase synthesis, for example, the amino acid corresponding to the C-terminus of the peptide to be synthesized is bound to a support which is insoluble 15 in organic solvents, and by alternate repetition of reactions, one wherein amino acids with their amino groups and side chain functional groups protected with appropriate protective groups are condensed one by one in order from the C-terminus to the N- terminus, and WO 2013/098337 PCT/EP2012/076968 8 one where the amino acids bound to the resin or the protective group of the amino groups of the peptides are released, the peptide chain is thus extended in this manner. Solid phase synthesis methods are largely classified by the tBoc method and the Fmoc method, depending on the type of protective group used. Typically used protective groups include 5 tBoc (t-butoxycarbonyl), CI-Z (2-chlorobenzyloxycarbonyl), Br-Z (2 bromobenzyloyycarbonyl), Bzl (benzyl), Fmoc (9-fluorenylmcthoxycarbonyl), Mbh (4, 4' dimethoxydibenzhydryl), Mtr (4-methoxy-2, 3, 6-trimethylbenzenesulphonyl), Trt (trityl), Tos (tosyl), Z (benzyloxycarbonyl) and Clz-Bzl (2, 6-dichlorobenzyl) for the amino groups; N02 (nitro) and Pmc (2,2, 5,7, 8-pentamethylchromane-6-sulphonyl) for the guanidino 10 groups); and tBu (t-butyl) for the hydroxyl groups). After synthesis of the desired peptide, it is subjected to the de-protection reaction and cut out from the solid support. Such peptide cutting reaction may be carried with hydrogen fluoride or tri-fluoromethane sulfonic acid for the Boc method, and with TFA for the Fmoc method. Alternatively, the peptide may be synthesized using recombinant techniques. In this 15 case, a nucleic acid and/or a genetic construct. comprising or consisting of a nucleotidic sequence encoding a peptide according to the invention, polynucleotides with nucleotidic sequences complementary to one of the above sequences and sequences hybridizing to said polynucleotides under stringent conditions. The invention further relates to a genetic construct consisting of or comprising a 20 polynucleotide as defined herein, and regulatory sequences (such as a suitable promoter(s), enhancer(s), terminator(s), etc.) allowing the expression (e.g. transcription and translation) of a peptide according to the invention in a host cell. Thus, in another aspect, the invention relates to a host or host cell that expresses (or that under suitable circumstances is capable of expressing) a peptide of the invention; 25 and/or that contains a polynucleotide of the invention or genetic construct of the invention. The method of producing the peptide may optionally comprise the steps of purifying said peptide, chemically modifying said peptide, and/or formulating said peptide into a pharmaceutical composition. 30 Chimeric constructs: The peptide Xr-KKKIK-t-El-X 2 X 3 (1) (SEQ ID NO:1) is useful in the invention as cell penetrating peptide (CPP). The invention thus provides vectors, comprising said peptide, as a cell penetrating 35 peptide, coupled to a molecule of interest. The molecule of interest may be coupled to one or several such CPP. WO 2013/098337 PCT/EP2012/076968 9 The molecule of interest may be any therapeutic agent, including a cytotoxic agent (preferably a pro-apoptotic peptide), an anti-viral agent, or anti-bacterial, or anti-parasitic agent. In a preferred embodiment, chimeric peptide constructs, comprising said peptide, as a 5 penetrating peptide, fused to a pro-apoptotic peptide, can be prepared. Preferably the pro-apoptotic peptide is fused at the C-term of the penetrating peptide. The pro-apoptotic peptide may be of any pro-apoptotic peptide of interest. The chimeric peptide construct may preferably have a length comprised between 23 to 70 amino acids, preferably between 23 to 40 amino acids. 10 In a preferred embodiment, the pro-apoptotic peptide is a fragment of caspase-9 protein. According to one embodiment, chimeric peptide constructs useful in the invention comprise, or consist in the following amino acid sequence: 15 Y-X 4 a.ETLD- X 4 b-I-X 5 -EQWA-X6-S-Xy (SEQ ID NO:3) wherein X 4 a is valine or isoleucine; X4b is aspartic acid or glycine; X 5 is phenylalanine or leucine; 20 X 6 is arginine or histidine; X 7 is vacant or is glutamate, or glutamate-aspartate, or glutamate-aspartate-leucine; or a proteolysis-resistant peptide deriving from said pro-apoptotic peptide by one or more chemical modifications, or a substantially homologous peptide deriving from SEQ ID 25 NO:3 by one or more conservative substitutions. Such proteolysis-resistant or homologous peptides induce cell apoptosis, in vitro and/or in vivo. Assays for determining if a molecule, for instance a peptide, induces cell apoptosis are well-known in the art and include, for instance, incubating cells with the candidate 30 peptide and determining if apoptosis is induced by said candidate peptide, e.g. by Annexin V and PI labelling of cells and identifying as apoptotic cells, those being Annexin V* and PI-. In a preferred embodiment, 35 X 4 a is valine; X4bis aspartic acid; WO 2013/098337 PCT/EP2012/076968 10 X 5 is phenylalanine; and X 6 is histidine. In a particular embodiment, the chimeric peptide construct is 5 VKKKKIKAEIKI-YVETLDDIFEQWAHSEDL (SEQ ID NO:4) also herein designated Mut3-DPT-C9h. In another particular embodiment, the chimeric peptide construct is VKKKKIKAEIKI-YIETLDDILEQWARSEDL (SEQ ID NO:5) 10 In another particular embodiment, the chimeric peptide construct is VKKKKIKKEIKI-YVETLDDIFEQWAHSEDL (SEQ ID NO:12) also herein designated Mutl-DPT-C9h. 15 In another particular embodiment, the chimeric peptide construct is VKKKKIKKEIKI-YIETLDDILEQWARSEDL (SEQ ID NO:13) In a particular embodiment, the chimeric peptide construct is VKKKKIKNEIKI-YVETLDDIFEQWAHSEDL (SEQ ID NO:14) 20 also herein designated Mut2-DPT-C9h. In still another particular embodiment, the chimeric peptide construct is VKKKKIKNEIKI-YIETLDDILEQWARSEDL (SEQ ID NO:15) 25 In still another embodiment, the pro-apoptotic peptide is a PP2Ah peptide that comprises or consists of: a) the amino acid sequence DTLDHIRALDRLQEVPHEGP (SEQ ID NO:8); b) an amino acid sequence substantially homologous to SEQ ID NO:8, preferably at least 80% identical to SEQ ID NO:8, which induces cell apoptosis; or 30 c) a proteolysis-resistant peptide which induces cell apoptosis and which derives from the peptide defined in a) or b) by one or more chemical modifications. In a preferred embodiment, the pro-apoptotic peptide comprises or consists of the sequence DTLDHIRALDRLQEVPHEGP (SEQ ID NO: 9). In a particular embodiment, the chimeric peptide construct is 35 VKKKKIKAEIKI- DTLDHIRALDRLQEVPHEGP (SEQ ID NO:16) WO 2013/098337 PCT/EP2012/076968 11 In another particular embodiment, the chimeric peptide construct is VKKKKIKKEIKI- DTLDHIRALDRLQEVPHEGP (SEQ ID NO:17) 5 In still another particular embodiment, the chimeric peptide construct is VKKKKIKNEIKI- DTLDHIRALDRLQEVPHEGP (SEQ ID NO:18) Further protection against proteolysis: The N- and C-termini of the peptides described herein may be optionally protected 10 against proteolysis. For instance, the N-terminus may be in the form of an acetyl group, and/or the C-terminus may be in the form of an amide group. Internal modifications of the peptides to be resistant to proteolysis are also envisioned, e.g. wherein at least a -CONH peptide bond is modified and replaced by a (CH2NH) reduced bond, a (NHCO) retro inverso bond, a (CH2-0) methylene-oxy bond, a (CH2-S) thiomethylene bond, a 15 (CH2CH2) carba bond, a (CO-CH2) cetomethylene bond, a (CHOH-CH2) hydroxyethylene bond), a (N-N) bound, a E-alcene bond or also a -CH=CH-bond. For instance the peptide may be modified by acetylation, acylation, amidation, cross linking, cyclization, disulfide bond formation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, 20 GPI anchor formation, hydroxylation, iodination, methylation, myristylation, oxidation, phosphorylation, and the like. The peptides of the invention may be composed of amino acid(s) in D configuration, which render the peptides resistant to proteolysis. They may also be stabilized by intramolecular crosslinking, e.g. by modifying at least two amino acid residues with olefinic 25 side chains, preferably C3-C8 alkenyl chains, preferably penten-2-yl chains, followed by chemical crosslinking of the chains, according to the so-called "staple" technology described in Walensky et al, 2004. For instance, amino acids at position i and i+4 to i+7 can be substituted by non-natural aminoacids that show reactive olefinic residues. All these proteolysis-resistant chemically-modified peptides are encompassed in the present 30 invention. In another aspect of the invention, peptides are covalently bound to a polyethylene glycol (PEG) molecule by their C-terminal terminus or a lysine residue, notably a PEG of 1500 or 4000 MW, for a decrease in urinary clearance and in therapeutic doses used and for an increase of the half-life in blood plasma. In yet another embodiment, peptide half 35 life is increased by including the peptide in a biodegradable and biocompatible polymer material for drug delivery system forming microspheres. Polymers and copolymers are, for WO 2013/098337 PCT/EP2012/076968 12 instance, poly(D,L-lactide-co-glycolide) (PLGA) (as illustrated in US2007/0184015, SoonKap Hahn et al). Nucleic acids 5 The invention also relates to a polynucleotide comprising or consisting of a nucleotide sequence encoding a peptide according to the invention. The invention further relates to a genetic construct consisting of or comprising a polynucleotide as defined herein, and regulatory sequences (such as a suitable promoter(s), enhancer(s), terminator(s), etc.) allowing the expression (e.g. transcription 10 and translation) of a peptide according to the invention in a host cell. The genetic constructs of the invention may be DNA or RNA, and are preferably double-stranded DNA. The genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism, in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for 15 independent replication, maintenance and/or inheritance in the intended host organism. For instance, the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral vector or transposon. In particular, the vector may be an expression vector, i.e. a vector that can provide for expression in vitro and/or in vivo (e.g. in a suitable host cell, host organism and/or expression system). 20 In a preferred but non-limiting aspect, a genetic construct of the invention comprises i) at least one nucleic acid of the invention; operably connected to ii) one or more regulatory elements, such as a promoter and optionally a suitable terminator; and optionally also iii) one or more further elements of genetic constructs such as 3'- or 5'-UTR sequences, leader sequences, selection markers, expression markers/reporter genes, and/or 25 elements that may facilitate or increase (the efficiency of) transformation or integration. In a particular embodiment, the nucleic acid encoding the cell-penetrating peptide of the invention is coupled or fused to a nucleic acid that encodes a peptide or protein of interest. The peptide of interest may be a pro-apoptotic peptide as described herein. More generally it may the peptide or protein of interest may be any peptide or protein to 30 express, such as therapeutic peptide or polypeptide, as well as any antigenic or immunogenic peptide if desired. The nucleic acid may especially be carried by a viral vector, such as an adenovirus or a lentivirus, for ex vivo or in vivo infection and expression of the peptide or protein of interest coupled to the cell-penetrating peptide. 35 WO 2013/098337 PCT/EP2012/076968 13 Pro-apoptotic activity: The chimeric peptides as defined herein, or nucleic acids that encode said peptides, are useful for inhibition of cell proliferation in vitro or in vivo. They are useful therapeutic agents, in particular for treating hyperproliferative 5 diseases. It is thus described a method of treatment of a hyperproliferative disease in a patient in need thereof, which method comprises administering said patient with the chimeric peptide construct, or a nucleic acid encoding said construct. The peptides (or nucleic acids that encode said peptides) are useful for the treatment 10 of a tumor, in particular a cancer tumor, preferably in a human patient. The hyperproliferative disorder may be cancer, such as a haematologic cancer, in particular acute myelogenous leukaemia (AML), chronic lymphocytic leukaemia (CLL), multiple myeloma, Hodgkin's disease, non-Hodgkin's lymphoma, B cell, cutaneous T cell lymphoma, or a non-haematologic cancer, for instance brain, epidermoid (in particular 15 lung, breast, ovarian), head and neck (squamous cell), bladder, gastric, pancreatic, head, neck, renal, prostate, colorectal, oesophageal or thyroid cancer, and melanoma. Different types of cancers may include, but are not limited to fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendothelio 20 sarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, lymphoma, leukemia, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinoma, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct 25 carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, melanoma, neuroblastoma, and retinoblastoma, uveal melanoma and 30 breast cancer. More particularly the peptides described herein (or nucleic acids that encode said peptides) are useful in the treatment of cancers which exhibit a deregulation of PP1 and/or PP2A or which exhibit an over-expression of the anti-apoptotic protein Bcl-2, an apoptotic regulator that interacts with and is controlled by PP1 and PP2A. 35 High levels of expression of the human bcl-2 gene have been found in all lymphomas with t (14; 18) chromosomal translocations including most follicular B cell lymphomas and WO 2013/098337 PCT/EP2012/076968 14 many large cell non-Hodgkin's lymphomas. High levels of expression of the bcl-2 gene have also been found in leukemias that do not have a t(14; 18) chromosomal translocation, including lymphocytic leukemias of the pre-B cell type, neuroblastomas, nasophryngeal carcinomas, and many adenocarcinomas of the prostate, breast, and 5 colon. Especially overexpression of bcl-2 was found in chronic lymphocytic leukemia (CLL) (Deng et al, 2009; Prickett et al, 2004). In a preferred embodiment, the cancer tumor is thus a lymphoma, especially a leukemia, such as chronic lymphocytic leukemia (CLL). Furthermore, the chimeric peptides (or nucleic acids that encode said peptides) may 10 be used for the treatment of metastases. According to another embodiment, the hyperproliferative disorder may be a non cancerous hyperproliferative disorder such as benign hyperplasia of the skin (e.g., psoriasis) or prostate (e.g., benign prostatic hypertrophy (BPH)), rheumatoid arthritis, 15 inflammatory bowel disease, osteoarthritis, leiomyomas, adenomas, lipomas, hemangiomas, fibromas, vascular occlusion, restenosis, atherosclerosis, or oral hairy leukoplakia. The chimeric peptides (or nucleic acids that encode said peptides) as described herein may also be used for treating parasitic diseases. 20 In particular, the chimeric peptides (or nucleic acids that encode said peptides) may have the ability to decrease the parasite load in a subject of at least 50%, 60%, 70%, 80%, 90% or 100%. The invention also provides a method of treatment of a parasitic disease in a patient in need thereof, which method comprises administering said patient with a chimeric 25 peptide or a nucleic acid that encode said peptide. Preferably, the parasitic disease is due to a parasite that belongs to the species Trypasonoma, Theileria or Plasmodium. The parasitic disease caused by the Trypanosoma may be sleeping sickness disease in humans, Chagas disease in humans, Nagana disease in ruminant livestock, 30 horses and pigs, Trypanosomiasis in birds, dourine or covering sickness in horses and other Equidae. The parasitic disease caused by Theileria may be the tropical theleriosis, the Mediterranean Coast Fever, the East Coast Fever or the equine or ovine piroplasmosis. The parasitic disease caused by Plasmodium may be malaria. 35 WO 2013/098337 PCT/EP2012/076968 15 Pharmaceutical compositions: The vectors of the invention, in particular chimeric peptides (or nucleic acid that encode said peptide) may be administered by any convenient route including intravenous, oral, transdermal, subcutaneous, mucosal, intramuscular, intrapulmonary, intranasal, 5 parenteral, rectal, vaginal and topical. Intranasal route is of particular interest. Advantageously, intra-tumoral administration is also contemplated. The therapeutic agent is formulated in association with a pharmaceutically acceptable carrier. The pharmaceutical composition may also include, or be combined with any other 10 active principle, such as in particular an anti-cancer agents, e.g. conventional cytotoxic chemotherapies with inhibitors of DNA replication such as DNA binding agents in particular alkylating or intercalating drugs, antimetabolite agents such as DNA polymerase inhibitors, or topoisomerase I or II inhibitors, or with anti-mitogenic agents such as alkaloids. In a further embodiment, the vectors of the invention, in particular chimeric 15 peptides (or nucleic acid that encode said peptide), may be combined with protease (kinase, aromatase, ATPase) inhibitors, monoclonal antibodies or hormones or hormone analogs. In a preferred embodiment, the therapeutic agent may be administered by electroporation. Electroporation, also known as electropermeabilization or electroinjection, 20 is the permeabilization of cell membranes as a consequence of the application of certain short and intense electric fields across the cell membrane, the cells or the tissues. Typically, electroporation consists of injecting compounds, preferably via intramuscular or intradermal route, followed by applying a series of electric pulses by means of electrodes connected to a generator. The conditions for applying an electric field in the injection zone 25 are now well known to those persons skilled in the art, and are in particular described in the US patent 5468223. Those persons skilled in the art will be able to adapt these conditions according to each case. The electric field may be 50-200 microseconds pulses of high-strength electric fields in the range of 1-5000 V/cm and with a frequency between 0.1 and 1,000 hertz. Typically, a sequence of eight 100 microseconds pulses of 1000 30 1500 V/cm with a frequency of 1 hertz is applied. The therapeutic agent, such as the chimeric peptide, is formulated in association with a pharmaceutically acceptable carrier. The preparation of a pharmacological composition that contains active ingredients dissolved or dispersed therein is well understood in the art and need not be limited based 35 on formulation. Typically such compositions are prepared as injectables either as liquid solutions or suspensions; however, solid forms suitable for solution, or suspensions, in WO 2013/098337 PCT/EP2012/076968 16 liquid prior to use can also be prepared. The preparation can also be emulsified. In particular, the pharmaceutical compositions may be formulated in solid dosage form, for example capsules, tablets, pills, powders, dragees or granules. The choice of vehicle and the content of active substance in the vehicle are generally 5 determined in accordance with the solubility and chemical properties of the active compound, the particular mode of administration and the provisions to be observed in pharmaceutical practice. For example, excipients such as lactose, sodium citrate, calcium carbonate, dicalcium phosphate and disintegrating agents such as starch, alginic acids and certain complex silicates combined with lubricants such as magnesium stearate, 10 sodium lauryl sulfate and talc may be used for preparing tablets. To prepare a capsule, it is advantageous to use lactose and high molecular weight polyethylene glycols. When aqueous suspensions are used they can contain emulsifying agents or agents which facilitate suspension. Diluents such as sucrose, ethanol, polyethylene glycol, propylene glycol, glycerol and chloroform or mixtures thereof may also be used. 15 Preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that may provide controlled or sustained release of the product. The dosing is selected by the skilled person so that a pro-apoptotic effect is achieved, 20 and depends on the route of administration and the dosage form that is used. Total daily dose of the chimeric peptide administered to a subject in single or divided doses may be in amounts, for example, of from about 0.001 to about 100 mg/kg body weight daily and preferably 0.01 to 10 mg/kg/day. Dosage unit compositions may contain such amounts of such submultiples thereof as may be used to make up the daily dose. It will be 25 understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the body weight, general health, sex, diet, time and route of administration, rates of absorption and excretion, combination with other drugs and the severity of the particular disease being treated. 30 Further aspects and advantages of the present invention will be disclosed in the following experimental section, which should be regarded as illustrative and not limiting the scope of the present application. WO 2013/098337 PCT/EP2012/076968 17 LEGENDS TO THE FIGURES: Figure 1 is a graph that shows stability of the mutated peptides analyzed by Proteominer fractionation and Maldi-Tof. The ratio of intensity of each pick is represented, relative to its own control. The R residue was mutated to K (Mutl-DPT-C9h), N (Mut2 5 DPT-C9h) or A (Mut3-DPT-C9h). Round: control DPT-C9h peptide (SEQ ID NO:6), Square: Mut1-DPT-C9h, Triangle: Mut2-DPT-C9h, Diamond: Mut3-DPT-C9h. Figure 2 shows an analysis of apoptosis by annexin-V-FITC staining of breast cancer cell line HBCx-12A was treated for24h with 100 pM of the control and mutated peptides. Figure 3 shows biodistribution of Cy5DPT-C9h and Cy5Mut3DPT-C9h. Mice were 10 grafted in interscapular by luminal breast cancer xenograft HBCx-3. They received one intraperitoneal injection of DPT-C9h or Mut3DPT-C9h labelled with Cy5 at 5 mg/kg. Control mouse received the control excipient (glucose 5%). Mice were imaged between 0 (prior to injection) and 168h after injection. Fluorescence of the tumors was calculated and normalized by using Living Image software. 15 EXAMPLES: Example 1: Design and characterization of mutated non-degradable DPT-C9h penetrating peptides 20 1.1. Materials and methods Peptide synthesis and sequence Peptides were synthesized in an automated multiple peptide synthesizer with solid phase procedure and standard Fmoc chemistry. The purity and composition of the 25 peptides were confirmed by reverse phase HPLC and by amino acid analysis. Analysis peptide stability in human serum Analysis of peptides degradation was done by Proteominer and Maldi-Tof as previously described. 1.2. Results 30 DPT-C9h is VKKKKIKREIKI-YVETLDDIFEQWAHSEDL (SEQ ID NO:6), The R residue was mutated to K (Mutl-DPT-C9h), N (Mut2-DPT-C9h) or A (Mut3 DPT-C9h). Figure 1 shows that Mut3-DPC-C9h peptide is not degraded upon 24h of contact with the human serum. In addition, the other mutants showed a higher stability compared to 35 control peptide (DPT-C9h). WO 2013/098337 PCT/EP2012/076968 18 Example 2: Effect of mutated DPT-C9h on apoptosis 2.1. Materials and methods 5 Cells Human breast cancer HBCx-12A, cell line has been isolated from primary human cancer xenografts and was cultured in RPMI medium supplemented with 10% of FCS. Detection of apoptosis by annexin-V-FITC staining Apoptotic cells were detected using Annexin-V (-FITC from BD biosciences) as 10 described by the manufacturer. Briefly, the cells were washed in 1x binding buffer, centrifugated and then resuspended in 200 pl of 1x binding buffer containing Annexin V FITC (0.1 pg/ml) and PI (0.5 pg/ml). After incubation at room temperature in the dark for 10 min, cells were analyzed by flow cytometry. Data acquired by FACSCalibur (BD biosciences) were analyzed with Cellquest Pro software. 15 2.2. Results The inventors have then analyzed whether the mutated peptides retain the capacity to induce apoptosis. The breast cancer cell line HBCx-12A was treated for 24h with 100 pM of the control and mutated peptides. Apoptosis was analyzed by annexin-V-FITC staining. As shown in Figure 2, the analyzed peptides induce similar levels of apoptosis. The same 20 result was observed when using the cell lines HBC-x3 and HBCx-17. Example 3: Biodistribution of Mut3DPT-C9h in tumors 3.1. Materials and methods 25 Peptide synthesis and sequence Peptides (DPT-C9h and Mut3DPT-C9h) were synthesized as described above. The fluorochrome Cy5 was added during the synthesis of the peptide. Fluorescence assays Mice were IP (intraperitonally) -injected with the peptide Cy5DPT-C9h or Mut3DPT 30 C9h (5 mg/kg) and then analyzed at different times after injection. Fluorescence imaging was performed with the IVIS imaging system (IVIS100, Caliper Life Sciences, USA). Mice were anesthetized upon analysis. Imaging acquisition time was from 1 s to 10 s, depending on the fluorescence signal. Analysis was performed using software Living Image V. 2.50 (Caliper Life Sciences). 35 3.2. Results Biodistribution of Mut3DPT-C9h and DPT-C9h in the breast cancer xenograft models. WO 2013/098337 PCT/EP2012/076968 19 The inventors were interested in analyzing and comparing the biodistribution of both peptides. Figure 3 shows the biodistribution of Cy5DPT-C9h and Cy5Mut3DPT-C9h in a breast cancer xenograft model. Mice were intraperitonally (IP) injected and biodistribution analyzed at different times upon injection. 5 Figure 3 shows that 6 h after IP injection, the inventors were able to detect both peptides in the tumor. The maximal peak of detection of Cy5 Mut3DPT-C9h is detected 23h after injection, slightly decreasing the intensity of the fluorescence after this time. Finally, considerable level of Cy5Mut3DPT-C9h was detected 168h after injection. The maximum level of Cy5DPT-C9h fluorescence was detected 6h after injection, slightly 10 decreasing after this period of time. Low level of Cy5DPT-C9h was detected upon 168h of treatment. Taken together, these results show that Cy5-labelled DPT-C9h and Cy5-labelled Mut3DPT-C9h reach the tumor. More importantly, Cy5- labelled Mut3DPT-C9h showed to be more stable that the original peptide, DPT-C9h. 15 The mutated peptide Mut3DPT-C9h shows a biodistribution in the tumor more sustained than the original peptide (DPT-C9h) since we are able to detect the fluorescence of the Cy5 fluorochrome longer that the fluorescence of DPT-C9h. This new property will allow to reduce the dose of peptide injected as well as the schedule of administration. In summary, the new mutants have a clear new advantage 20 compared to control peptide and have a new characteristic since they are not degradable by serum proteases. WO 2013/098337 PCT/EP2012/076968 20 REFERENCES 5 - Deng X, Gao F, and W. Stratford May. Dephosphorylation and up-regulation of Bcl2 p53 binding Protein phosphatase 2A inactivates Bcl-2's antiapoptotic function by dephosphorylation and up-regulation of Bcl2-p53 binding. Blood. 2009 Jan 10 8;113(2):422-8.. - Guergnon, F. Dessauge, V. Dominguez, J. Viallet, X. Cayla, A. Rebollo, V.Yuste, S.Susin, PE. Bost and A. Garcia Use of penetrating peptides interacting with PP1/PP2A proteins as a basis for a new Drug Phosphatase Technology. Mol. Pharmacol. (2006) 69 :1115-1124. 15 - Lehninger, (1975) Biochemistry, Second Edition, Worth Publishers, Inc. New-York: NY., pp. 71-77. - Pitton, C., Rebollo, A., Van Snick, J., Theze, J. and Garcia, A. (1993) High affinity and intermediate affinity forms of the human IL-2 receptor expressed in an IL-9 dependent murine T cell line deliver proliferative signals via differences in their 20 transduction pathways. Cytokine, 5, 362-371. - Prickett TD, and Brautigan D (2004). Ovelapping binding sites in Protein Phosphatase 2A for association with regulatory 1 and a4 (mTap42) subunits. J.Biol.Chem. 279,38912-38920. - Walensky et al, Science, 2004, 305:1466-1470 25
权利要求:
Claims (18) [1] 1. A peptide comprising the following amino acid sequence (1): X 1 -KKKIK-W-El-X 2 -X 3 (I) (SEQ ID NO:1) 5 wherein X 1 is vacant, is a lysine residue, or valine-lysine; X 2 is vacant, is a lysine residue, or lysine-isoleucine; X 3 is vacant or is an amino acid sequence of 1 to 4 amino acids; and W is an amino acid residue that is different from arginine; or a proteolysis-resistant peptide deriving from sequence (1) by one or more chemical 10 modifications, or a substantially homologous peptide deriving from sequence (1) by one or more conservative substitutions. [2] 2. The peptide of claim 1, wherein LP is non-conservative with respect to arginine, and preferably is alanine. 15 [3] 3. The peptide of any of claims 1 or 2, wherein X 1 is valine-lysine; X 2 is lysine-isoleucine; and X 3 is vacant. 20 [4] 4. The peptide of claim 3, which is VKKKKIKAEIKI (SEQ ID NO:2) [5] 5. The peptide of claim 3, which is VKKKKIKKEIKI (SEQ ID NO:10), or 25 VKKKKIKNEIKI (SEQ ID NO:11). [6] 6. A vector comprising the peptide of any of claims 1 to 5, as a cell penetrating peptide, coupled to a molecule of interest. 30 [7] 7. The vector of claim 6 that is a chimeric peptide construct, comprising the peptide of any of claims 1 to 5, as a cell penetrating peptide, fused to a pro-apoptotic peptide, wherein the cell penetrating peptide is preferably fused at the N-terminus of the pro apoptotic peptide. 35 [8] 8. The chimeric peptide construct of claim 7, wherein the pro-apoptotic peptide comprises sequence Y-X 4 .ETLD- X 4 b1-X5-EQWA-X6-S-X 7 (SEQ ID NO:3) WO 2013/098337 PCT/EP2012/076968 22 wherein X 4 a is valine or isoleucine; X4b is aspartic acid or glycine; X 5 is phenylalanine or leucine; 5 X 6 is arginine or histidine; X 7 is vacant or is glutamate, or glutamate-aspartate, or glutamate-aspartate-leucine; or a proteolysis-resistant peptide deriving from said pro-apoptotic peptide by one or more chemical modifications, or a substantially homologous peptide deriving from SEQ 10 ID NO:3 by one or more conservative substitutions. [9] 9. The chimeric peptide construct of claim 8, wherein X 4 a is valine; X4b is aspartic acid; 15 X 5 is phenylalanine; and X 6 is histidine. [10] 10. The chimeric peptide construct of claim 9, which is VKKKKIKAEIKI-YVETLDDIFEQWAHSEDL (SEQ ID NO:4) or 20 VKKKKIKAEIKI-YIETLDDILEQWARSEDL (SEQ ID NO:5) [11] 11. The chimeric peptide construct of claim 7, wherein the pro-apoptotic peptide comprises or consists of: a) the amino acid sequence DTLDHIRALDRLQEVPHEGP (SEQ ID NO:8); 25 b) an amino acid sequence substantially homologous to SEQ ID NO:8, preferably at least 80% identical to SEQ ID NO:8, which induces cell apoptosis; or c) a proteolysis-resistant peptide which induces cell apoptosis and which derives from the peptide defined in a) or b) by one or more chemical modifications 30 [12] 12. The chimeric peptide construct of claim 11, wherein the pro-apoptotic peptide comprises or consists of the sequence DTLDHIRALDRLQEVPHEGP (SEQ ID NO: 9). [13] 13. The chimeric peptide construct of claim 12, which is selected from the 35 group consisting of: VKKKKIKAEIKI- DTLDHIRALDRLQEVPHEGP (SEQ ID NO:16) WO 2013/098337 PCT/EP2012/076968 23 VKKKKIKKEIKI- DTLDHIRALDRLQEVPHEGP (SEQ ID NO:17) and VKKKKIKNEIKI- DTLDHIRALDRLQEVPHEGP (SEQ ID NO:18) 5 [14] 14. A nucleic acid comprising a sequence coding for the peptide of any of claims 1 to 5 or for the chimeric peptide construct of any of claims 7 to 13. [15] 15. A vector comprising a nucleic acid comprising (i) a nucleotide sequence 10 coding for the peptide of any of claims 1 to 5 coupled to (ii) a nucleotide sequence of interest, for use in gene therapy or gene transfer in vivo or ex vivo. [16] 16. Use of chimeric peptide construct as defined in any one of claims 7 to 13, or of a nucleic acid encoding said chimeric peptide construct, for inhibition of cell 15 proliferation in vitro. [17] 17. A pharmaceutical composition, comprising the vector as defined in claim 15, or the chimeric peptide construct as defined in any of claims 7 to 13, in association with a pharmaceutically acceptable carrier. 20 [18] 18. The pharmaceutical composition of claim 17, for use in treating a hyperproliferative disease, wherein said hyperproliferative disease is preferably - (i) a non-cancerous hyperproliferative disorder selected from the group consisting of psoriasis, benign prostatic hypertrophy, rheumatoid arthritis, inflammatory bowel 25 disease, osteoarthritis, leiomyomas, adenomas, lipomas, hemangiomas, fibromas, vascular occlusion, restenosis, atherosclerosis, and oral hairy leukoplakia, and/or - (ii) a cancer selected from the group consisting of acute myelogenous leukaemia, chronic lymphocytic leukaemia, multiple myeloma, Hodgkin's disease, non-Hodkin's lymphoma, B cell, cutaneous T cell lymphoma, and brain, lung, breast, ovarian, head 30 and neck, bladder, gastric, pancreatic, head, neck, renal, prostate, colorectal, oesophageal, and thyroid cancer, uveal melanoma and melanoma; wherein the hyperproliferative disease is preferably a tumor, preferably a cancer tumor in a human patient, still preferably a lymphoma, even more preferably a chronic lymphocytic leukemia (CLL). 35 or a parasitic disease, wherein said parasitic disease is preferably due to an infection with a parasite selected from Trypanosoma, Theileria or Plasmodium.
类似技术:
公开号 | 公开日 | 专利标题 US9644001B2|2017-05-09|Cell-penetrating peptides CN1112367C|2003-06-25|Use of a pharmaceutical composition comprising an appetite-suppressing peptide CN106456697B|2019-12-17|Peptide having fibrosis-inhibiting activity and composition containing the same US11058744B2|2021-07-13|Composition for treating prostate cancer US20130303439A1|2013-11-14|Chimeric peptides including a penetrating peptide and a binding domain of pp2a catalytic subunit to caspase-9 US9364514B2|2016-06-14|Anti-tumor adjuvant therapy US20170015718A1|2017-01-19|Pro-apoptotic ras and raf peptides US10441628B2|2019-10-15|High activity tumour inhibitor and preparation method and use thereof TW201838647A|2018-11-01|A conjugate of insulin analog with reduced affinity to insulin receptor and use thereof US20180066241A1|2018-03-08|Pro-apoptotic set and pp2a peptides US10947276B2|2021-03-16|Cell penetrating peptides with improved internalization properties WO2016156538A1|2016-10-06|Peptides that inhibit binding between set and caspase-9 EP3272768A1|2018-01-24|Chimeric peptides useful in malaria prophylaxis or treatment EP3116893B1|2019-08-28|A chimeric peptide that interacts with cell membrane gangliosides Rebollo et al.2016|Peptides that inhibit binding between set and caspase-9 KR101990437B1|2019-06-19|Peptide from Parapolybia varia having antitumor activity and uses thereof
同族专利:
公开号 | 公开日 KR20140128971A|2014-11-06| ES2748937T3|2020-03-18| US9353155B2|2016-05-31| CN104271147A|2015-01-07| EP2797616B1|2019-07-31| EP2797616A1|2014-11-05| KR102071514B1|2020-01-30| IL233280A|2019-08-29| DK2797616T3|2019-10-07| SG10201607271SA|2016-10-28| JP6169606B2|2017-07-26| CA2859712A1|2013-07-04| IL233280D0|2014-08-31| PL2797616T3|2020-03-31| AU2012360845B2|2017-05-11| BR112014016076A2|2017-06-13| BR112014016076A8|2017-07-04| WO2013098337A1|2013-07-04| CN104271147B|2018-01-12| US9644001B2|2017-05-09| SG11201403683PA|2014-10-30| US20140364376A1|2014-12-11| JP2015504050A|2015-02-05| US20160257713A1|2016-09-08|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题 US5468223A|1992-11-30|1995-11-21|C.N.R.S. Paris|Electrochemotherapy| WO2004011595A2|2002-07-26|2004-02-05|Institut Pasteur|Vectors for transferring molecules of interest in target cells| FR2827866B1|2001-07-27|2004-12-10|Pasteur Institut|SYNTHETIC OR NATURAL PEPTIDES BINDING PROTEIN PHOSPHATASE 2A, IDENTIFICATION METHOD AND USES| US7745574B2|2005-05-12|2010-06-29|The Burnham Institute|Compounds that regulate apoptosis| US20070184015A1|2006-02-03|2007-08-09|Soonkap Hahn|Novel PEGylation agent| CN101412747B|2008-10-21|2011-04-20|中国药科大学|Novel cell-penetrating peptide and uses thereof| EP2236603A1|2009-03-30|2010-10-06|Universite Pierre Et Marie Curie|Pro-apoptotic peptides| US9364514B2|2011-12-27|2016-06-14|Institute Curie|Anti-tumor adjuvant therapy|US9364514B2|2011-12-27|2016-06-14|Institute Curie|Anti-tumor adjuvant therapy| WO2015001045A2|2013-07-03|2015-01-08|Universite Pierre Et Marie Curie |Pro-apoptotic ras and raf peptides| EP2868326A1|2013-11-04|2015-05-06|Université Pierre et Marie Curie |Peptide inhibitors of TEAD/YAP-TAZ interaction| EP2881472A1|2013-12-09|2015-06-10|Université Pierre et Marie Curie |A method of predicting a response to an anti-tumor treatment| JP6551825B2|2014-02-10|2019-07-31|公立大学法人首都大学東京|Chromatin structure regulator| CN105315348B|2014-06-23|2018-10-16|天津药物研究院|A kind of transmembrane polypeptide and its preparation method and application| KR101835554B1|2014-06-24|2018-04-19|서울대학교 산학협력단|Composition comprising C/EBF for promoting differentiation or stability of induced regulatroy T cell and method therefor| EP3277804A1|2015-03-31|2018-02-07|Université Pierre et Marie Curie - Paris 6 |Pro-apoptotic set and pp2a peptides| CN105418733A|2015-06-23|2016-03-23|天津药物研究院有限公司|Preparation and application of conjugate of cell penetrating polypeptide and antitumor drug| EP3272768A1|2016-07-22|2018-01-24|Université Pierre et Marie Curie |Chimeric peptides useful in malaria prophylaxis or treatment| WO2018114863A1|2016-12-22|2018-06-28|Sorbonne Universite|Cell penetrating peptides with improved internalization properties| US11117930B2|2017-02-23|2021-09-14|Adrx, Inc.|Peptide inhibitors of transcription factor aggregation| CN106995487B|2017-04-17|2019-12-03|扬州大学|Application derived from Chicken Infectious Anemia Virus VP1-aa 23-43 polypeptide as high efficiency cell cell-penetrating peptide| CN106831957B|2017-04-17|2019-12-03|扬州大学|A kind of application derived from Chicken Infectious Anemia Virus VP1-aa 1-19 polypeptide as high efficiency cell cell-penetrating peptide| EP3634978A1|2017-06-07|2020-04-15|Adrx, Inc.|Tau aggregation inhibitors| US20200216495A1|2017-08-18|2020-07-09|Adrx, Inc.|Tau aggregation peptide inhibitors| CN111729070B|2020-06-02|2021-03-30|遵义医科大学珠海校区|Application of polypeptide FL15 in preparation of antitumor drugs|
法律状态:
2017-09-07| FGA| Letters patent sealed or granted (standard patent)| 2018-09-20| HB| Alteration of name in register|Owner name: SORBONNE UNIVERSITE Free format text: FORMER NAME(S): INSTITUT CURIE; UNIVERSITE PIERRE ET MARIE CURIE (PARIS 6) Owner name: INSTITUT CURIE Free format text: FORMER NAME(S): INSTITUT CURIE; UNIVERSITE PIERRE ET MARIE CURIE (PARIS 6) |
优先权:
[返回顶部]
申请号 | 申请日 | 专利标题 EP11306784.7||2011-12-27|| EP11306784||2011-12-27|| PCT/EP2012/076968|WO2013098337A1|2011-12-27|2012-12-27|Cell-penetrating peptides| 相关专利
Sulfonates, polymers, resist compositions and patterning process
Washing machine
Washing machine
Device for fixture finishing and tension adjusting of membrane
Structure for Equipping Band in a Plane Cathode Ray Tube
Process for preparation of 7 alpha-carboxyl 9, 11-epoxy steroids and intermediates useful therein an
国家/地区
|