![]() Novel TRPA1 antagonists
专利摘要:
The present invention relates to compositions and methods that modulate at least one TRP family member. Specifically, the present invention relates to novel TRPA1 antagonists and their use in the treatment of pain such as chronic inflammatory and neuropathic pain. Compounds that can modulate one or more TRPA1 functions are useful in many aspects including, but not limited to, maintaining calcium homeostasis; maintaining sodium homeostasis; modulating intracellular calcium levels; modulating membrane polarization (membrane potential); modulating cation levels; and/or treating or preventing diseases, disorders, or conditions associated with calcium homeostasis, sodium homeostasis, calcium or sodium dyshomeostasis, or membrane polarization/hyperpolarization (including hypo and hyperexcitability), and/or treating or preventing diseases, disorders, or conditions associated with regulation or misregulation of TRPA1 expression or function. The present invention further relates to methods and compositions that antagonize both a function of TRPA1 and a function of one or more additional TRP channels. 公开号:AU2010303822A1 申请号:U2010303822 申请日:2010-09-28 公开日:2012-03-15 发明作者:Mark T. Bilodeau;Melissa Egbertson;Ahren Green;John C. Hartnett;Yiwei Li 申请人:Merck Sharp and Dohme Corp; IPC主号:A61K31-555
专利说明:
WO 2011/043954 PCT/US2010/050493 TITLE OF THE INVENTION NOVEL TRPA1 ANTAGONISTS BACKGROUND OF THE INVENTION 5 The TRP channels constitute a large and important class of channels involved in modulating cellular homeostatis. The channels are generally classified into six groups: TRPC (short), TRPV (vanilloid), TRPM (long, melastatin), TRPP (polycystins), TRPML (mucolipins), and TRPA (Ankyrin). The TRPC family has four groups TRPC1, TRPC4,5, TRPC3,6,7 and TRPC2; based on sequence homology and functional similarities. The TRPV family has 6 10 members, including TRPV5 and TRPV6, which are more closely related to each other than to TRPV1, TRPV2, TRPV3, and TRPV4. The TRPM family has 8 members, TRPMI (Melastatin or LTRPCI), TRPM3 (KIAA16I6 or LTRPC3), TRPM7 (TRP-PLIK, ChaK(l), LTRPC7), TRPM6 (ChaK2), TRPM2 (TRPC7 or LTRPC2), TRPM8 (Trp-p8 or CMRI), TRPMS (Mtrl or LTRPC5), and TRPM4 (FLJ2004I or LTRPC4). The sole mammalian member of the TRPA 15 family is ANKTMI, also known as TRPA1. TRPAI is most closely related to TRPV3, and is more closely related to TRPV1 and TRPV2 than to TRPV5 and TRPV6. The TRPML family include TRPMLI (mucolipins 1), TRPML2 (mucolipins 2), and TRPML3 (mucolipin3). The TRPP family contains two groups of channels, those believed to have six trans-membrane domains (TRPP2 (PKD2), TRPP3 (PKD2L1), TRPP5 (PKD2L2)) and those that have 11 (TRPPI 20 (PKDI, PC 1), PKD-REJ and PKD-l LI). TRPA1 is a non-selective cation channel and is the sole mammalian member that defines the TRPA subfamily. In addition to calcium ions, TRPAI channels are permeable to other cations, for example sodium and Zinc. Thus, TRPA1 channels modulate membrane potential by modulating the flux of cations. Although non-selective cation channels such as TRPA1 25 modulate, among other things, calcium ion flux, they are mechanistically distinct from voltage gated calcium channels. Voltage-gated calcium channels generally respond to depolarization of the potential difference across the membrane and can open to permit an influx of calcium from the extracellular medium and a rapid increase in intracellular calcium levels or concentrations. However, non-selective cation channels are generally signal transduction gated, long lasting, and 30 produce less rapid changes in ion concentration. These mechanistic differences are accompanied -1- WO 2011/043954 PCT/US2010/050493 by structural differences among voltage-gated and cation permeable channels. Thus, it is important to recognize the significant structural, functional, and mechanistic differences among different classes of ion channels even though many of the diverse channels act to regulate ion flux and membrane potential in various cell types and in response to numerous stimuli. 5 TRPA1 was shown to be highly expressed in dorsal root, trigeminal, and nodose ganglia in a specific subpopulation of neurons coexpressing another transient receptor potential family member, TRPV 1, and in the hair cells of the inner ear (See Corey DP, et al., Nature 2004, 432(7018):723-730; Diogenes A, et al., JDent Res 2007, 86(6):550-555; and Story GM, et al, Cell 2003, 112(6):819-829). After originally being characterized as a noxious cold-activated ion 10 channel, several reports showed that TRPA1 can be activated by a large number of pungent or irritant compounds, such as cinnamaldehyde, AITC, acrolein, allicin, and formalin, all of which can induce acute pain, hyperalgesia, or neurogenic inflammation in animals and humans (See McNamara CR, et al., Proc Natl Acad Sci USA 2007, 104(33):13525-13530; Jordt SE, et al., Nature 2004, 427(6971):260-265 ; Macpherson LJ, et al., Curr Biol 2005, 15(10):929-934 ; 15 Macpherson LJ, et al., JNeurosci 2007, 27(42):11412-11415 ; Namer B, et al., Neuroreport 2005, 16(9):955-959; and Ward L, et al., Pain 1996, 64(l):129-138). Additionally, these compounds have been shown to activate primary afferent nociceptors and enhance spontaneous and stimulus-evoked responses of spinal dorsal horn sensory neurons following peripheral application. More recently, the alpha, beta-unsaturated aldehyde, 4-hydroxy-2-nonenal (INE) 20 and the electrophilic carbon-containing PGJ2 metabolite, 15dPGJ2, released in response to tissue injury, inflammation, and oxidative stress, were reported to be the first endogenous activators of TRPAI (Taylor-Clark TE, et al., Mol Pharmacol 2008, 73(2):274-28 1; and Trevisani M, et al.,Proc Natl AcadSci USA 2007, 104(33):13519-13524). It has also been reported that the majority of TRPA1 activators gate the channel through chemical reactivity of their electrophilic 25 groups with some of the nucleophilic cysteine residues at the N-terminus of the channel and that TRPAI can be gated through another mode of activation involving its N-terminal EF-hand calcium binding domain (See Hinman A, et al., Proc Natl Acad Sci USA 2006, 103(51):19564 19568; Macpherson LJ, et al., Nature 2007, 445(7127):541-545). See also TRPAI (Jordt et al. -2- WO 2011/043954 PCT/US2010/050493 (2004) Nature 427:260-265; Bautista et al., (2005) PNAS: 102(34):12248-12252), W02007073505, US2007219222, US5369094, and US2007196866. The recent discoveries and descriptions of the transient receptor potential family of receptors, including TRPV1 and TRPA1, has provided a number of potential new therapeutic 5 targets for treating chronic and acute pain, including acute formalin and CFA induced pain. Safe and effective treatment for chronic inflammatory and neuropathic pain remains a key unmet medical need for many patients. SUMMARY OF THE INVENTION 10 The present invention relates to compositions and methods that modulate at least one TRP family member. Specifically, the present invention relates to novel TRPA1 antagonists and their use in the treatment of pain such as chronic inflammatory and neuropathic pain. Antagonizing a function of TRPAl provides a means for modulating calcium homeostasis, sodium homeostasis, intracellular calcium levels, membrane polarization (resting 15 membrane potential), and/or cation levels in a cell. Compounds that can modulate one or more TRPAI functions are useful in many aspects including, but not limited to, maintaining calcium homeostasis; maintaining sodium homeostasis; modulating intracellular calcium levels; modulating membrane polarization (membrane potential); modulating cation levels; and/or treating or preventing diseases, disorders, or conditions associated with calcium homeostasis, 20 sodium homeostasis, calcium or sodium dyshomeostasis, or membrane polarization/hyperpolarization (including hypo and hyperexcitability), and/or treating or preventing diseases, disorders, or conditions associated with regulation or misregulation of TRPA1 expression or function. The present invention further relates to methods and compositions that antagonize both a function of TRPA1 and a function of one or more 25 additional TRP channels. The present invention provides compounds that modulate TRPAI function, and methods employing these compounds. Another aspect of the invention is a method of modulating a TRPAI function in a cell or animal comprising administering an effective amount of a compound that inhibits a TRPAI function, wherein the compound inhibits a TRPAl-mediated -3 - WO 2011/043954 PCT/US2010/050493 ion flux. Another aspect of the invention relates to a method of modulating a TRPA1 function in a cell comprising administering to the cell an effective amount of a compound that inhibits TRPA1 function, wherein the compound inhibits calcium influx mediated by TRPA1. Another aspect of the present invention relates to a method of preventing or treating a disease or condition 5 related to TRPAl function in a subject comprising administering to the subject a therapeutically effective amount of a compound that inhibits TRPA1 function, wherein the compound inhibits the calcium influx mediated by TRPA1. Still another aspect of the present invention relates to method of preventing or treating a disease- or condition related to TRPA I function in a subject comprising administering to the subject a therapeutically effective amount of a compound that 10 inhibits TRPA 1 function, wherein the compound inhibits the calcium flux mediated by TRPA 1. Inhibition of the calcium influx refers to the ability of a compound to inhibit that calcium influx in either an in vitro or an in vivo assay. Inhibition of calcium flux in either an in vivo or an in vitro assay serves as a proxy for the particular functional activity of the particular compound. These and other aspects of the invention will be realized upon review of the 15 specification in its entirety. DETAILED DESCRIPTION OF THE INVENTION The present invention is directed to compounds of Formula I: R. -R 4 U 20 Y WX I or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt wherein: W represents CH2, NC(O)R 4 , NC(O)NR 3 R 4 , NR 4 , CHR 4 , -0 25 U, X, Y, and Z independently represent CR2, or -0-; R 2 represents hydrogen, or C1 -6 alkyl; -4- WO 2011/043954 PCT/US2010/050493 R 5 represents hydrogen, or C1-6 alkyl, C(O)N(R 2 )2, C(O)R 2 , C(O)O(CH2)nC6-10 aryl, (CHR 2 )nC5-10 heterocyclyl, (CHR 2 )nC6-10 aryl; said alkyl, heterocyclyl and aryl optionally substituted with 1 to 3 groups of Ra; 5 R 3 and R 4 independently represent H, (CH2)nOR 2 , (CH2)nOR 5 , CH(OR 2 )2, CH2O(CH2)nOR2, CHF2, (CH2)nNR2RS, (CHR 2 )nC5-10 heterocyclyl, (CHR 2 )nC6-10 aryl, (CHR 2 )nC3-10 cycloalkyl, C1-6 alkoxy, C2-6 alkenyl, CF3, CF2, CH2Si(C5-6 aryl)2R 2 , C(0)1 2R 2 , or C1-6 alkyl; said alkyl, cycloalkyl, heterocyclyl and aryl optionally substituted with I to 3 10 groups of Ra; or R 3 and R 4 can be combined with the nitrogen to which they are attached to form a C5-10 heterocyclyl optionally containing one or more additional heteroatoms selected from 0, N, and S and optionally substituted with 1 to 3 groups of Ra; 15 Ra represents C1-6 alkyl, halogen, hydroxyl, OR 2 , (CH2)nCF3, C3-6 cycloalkyl, C(O)N(R 2 )2, C(R 2 )20R 2 , C(O)R 2 , N02, CN, N(R 2 )2, C(0)OR2, (CH2)nC5-10 heterocyclyl, or (CH2)nC6 10 aryl, said heterocyclyl and aryl optionally substituted with I to 3 groups of C1-6 alkyl, halogen, hydroxyl, (CH2)nCF3,or CN; and 20 n represents 0 to 4. Another aspect of this invention is realized when R5 is hydrogen and all other variables are as originally described. 25 Another aspect of this invention is realized when R5 is C1-6 alkyl and all other variables are as originally described. A sub-embodiment of this invention is realized when R5 is methyl. Another aspect of this invention is realized when R3 and R4 are independently selected from the group consisting of H, (CHR 2 )nC5- 10 heterocyclyl, (CHR 2 )nC6- 10 aryl, 30 (CHR 2 )nC3-10 cycloalkyl, or C1-6 alkyl; said alkyl, cycloalkyl, heterocyclyl and aryl optionally substituted with 1 to 3 groups of Ra and all other variables are as originally described. A subembodiment of this aspect of R 3 and R4 is realized when one of R3 and R 4 is hydrogen, or CH3, and the other is not. A further subembodiment of this aspect of R3 and R4 is realized -5- WO 2011/043954 PCT/US2010/050493 when one of R 3 and R 4 is hydrogen and the other is selected from the group consisting of C 1-6 alkyl, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, indeneyl, (CHR 2 )nphenyl, (CHR 2 )nindolyl, (CHR 2 )nnapthyl, piperonyl, (CHR 2 )npridyl, (CHR 2 )nimidazolyl, (CHR 2 )npyrimidinyl, pyranoyl, (CHR 2 )nquinolinyl, (CHR 2 )nisoquinolinyl, all optionally 5 substituted with 1 to 3 groups of Ra and all other variables are as originally described. A subembodiment of this aspect of R 3 and R 4 is realized when the C1-6 alkyl is selected from the group consisting of methyl, ethyl, propyl, isopropyl, butyl, isobutyl, and the like, all of which are optionally substituted with 1 to 3 groups of Ra. Another aspect of this invention is realized when-R 3 and R4 are combined with 10 the nitrogen to which they are attached to form a C5-10 heterocyclyl optionally containing one or more additional heteroatoms selected from 0, N and S, and optionally substituted with I to 3 groups of Ra and all other variables are as originally described. A subembodiment of this aspect of R 3 and R4 is realized when they are combined to form morpholinyl. Another aspect of this invention is realized when Ra is selected from the group 15 consisting of C1-6 alkyl, halogen, CN, OR2, (CH2)nCF3, C3-6 cycloalkyl, (CH2)nC5-10 heterocyclyl, or (CH2)nC6-1 0 aryl, said heterocyclyl and aryl optionally substituted with 1 to 3 groups of C 1-6 alkyl, halogen, hydroxyl, (CH2)nCF3,or CN. A subembodiment of this aspect of Ra is realized when it is selected from the group consisting of fluorine, chlorine, methoxy, methyl, ethyl, propyl, butyl, OH, CN, CF3, and OR 2 . 20 Another aspect of this invention is realized when W is -CHR 4 and all other variables are as originally described. A sub-embodiment of this invention is realized when R4 is H. Another sub-embodiment of this invention is realized when R 4 is selected from the group consisting of (CH2)nC5-10 heterocyclyl, Cl -6 alkoxy, (CH2)nOH and CH20Si(Phenyl)2R 2 , said heterocyclyl, alkoxy and phenyl optionally substituted with I to 3 groups of Ra. 25 Still another aspect of this invention is realized when W is NR 4 and all other variables are as originally described. Yet another aspect of this invention is realized when W is -O- and all other variables are as originally described. -6- WO 2011/043954 PCT/US2010/050493 Another aspect of this invention is realized when W is - NC(O)R 4 and all other variables are as originally described. A subembodiment of this invention is realized when R 4 is selected from the group consisting of (CH2)nC5-10 heterocyclyl, (CH2)nC6-10 aryl, (CH2)nC3 10 cycloalkyl, or C1 -6 alkyl, said alkyl,heterocyclyl, aryl, and cycloalkyl optionally substituented 5 with 1 to 3 groups of Ra. Still another subembodiment of this invention is realized when R 4 is selected from the group consisting of C1 -6 alkyl, (CH2)nphenyl, (CH2)nindenyl, pyranoyl, and, piperonyl, said alkyl, phenyl, and indenyl optionally substituented with 1 to 3 groups of Ra. Another aspect of this invention is realized when W is or -NC(O)NR 3 R 4 - and all other variables are as originally described. A subembodiment of this invention is realized when 10 one of R 3 and R 4 is hydrogen and the other is selected from the group consisting of (CH2)nC5 10 heterocyclyl, (CH2)nC6-10 aryl, (CH2)nC3-10 cycloalkyl, or C1-6 alkyl, said alkyl,heterocyclyl, aryl, and cycloalkyl optionally substituented with I to 3 groups of Ra.. Still another subembodiment of this invention is realized when one of R 3 and R 4 is hydrogen and the other is selected from the group consisting of C1-6 alkyl, and (CH2)njphenyl, said alkyl, and 15 phenyl optionally substituented with I to 3 groups of Ra. Yet another aspect of this invention is realized when W, U, Z, Y and X are CH2 and all other variables are as originally described. Still another aspect of this invention is realized when W is NC(O)R 4 , U, Z, Y and X are CH2, and all other variables are as originally described. 20 Another aspect of this invention is realized when W is NC(O)NR 3 R 4 , U, Z, Y and X are CH2, and all other variables are as originally described. Another aspect of this invention is realized when W is NR4, U, Z, Y and X are CH2, and all other variables are as originally described. Another aspect of this invention is realized when Y is -0-, W, U, Z and X are 25 CH2, and all other variables are as originally described. Another aspect of this invention is realized when X is -0-, W, U, Z and Y are CH2, and all other variables are as originally described. -7- WO 2011/043954 PCT/US2010/050493 Another aspect of this invention is realized when Z is -0-, W, U, Y and X are CH2, and all other variables are as originally described. Another aspect of this invention is realized when W is -0-, Z, U, Y and X are CH2, and all other variables are as originally described. 5 Still another aspect of this invention is realized with the compound of structural formula Ia: (CHR Tn HN R4 Ia or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or 10 prodrug of the compound or its salt,, wherein Ra and n are as described herein, and R 4 is selected from the group consisting of H, (CH2)nOR 2 , CI-(OR 2 )2, and CH2Si(C5-6 aryl)2R 2 . A subembodiment of the compound of formula Ia is realized when Ra is selected from the group consisting of C 1-6 alkyl, halogen, CN, OR 2 , (CH2)nCF3, C3-6 cycloalkyl, (CH2)nC5-10 heterocyclyl, or (CH2)nC6-10 aryl, said 15 heterocyclyl and aryl optionally substituted with 1 to 3 groups of Cl -6 alkyl, halogen, hydroxyl, (CH2)nCF3,or CN. A further subembodiment of this aspect of formula Ia is realized when Ra selected from the group consisting of fluorine, chlorine, methyl, ethyl, propyl, butyl, phenyl, tetrazolyl, OH, CN, CF3, and OR 2 , preferably fluorine, chlorine, phenyl, tetrazolyl, methyl, methoxy, OH, and CN. Another subembodiment of the compound of formula Ia is realized 20 when n is 0-3, preferably 0-2, 0-1 or 0. Still another subembodiment of the compound of formula Ia is realized when R 2 is hydrogen. Another subembodiment of the compound of formula Ia is realized when R 2 is methyl. -8 - WO 2011/043954 PCT/US2010/050493 Still another aspect of this invention is realized with the compound of structural formulas Ib: (CHR2) R 4 Th 5 or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt,wherein Ra and n are as described herein. A subembodiment of the compound of formula Ib is realized when Ra is selected from the group consisting of C1-6 alkyl, halogen, CN, O2, (CH2)nCF3, C3-6 cycloalkyl, (CH2)nC5-10 heterocyclyl, or (CH2)nC6- 10 aryl, said heterocyclyl and aryl optionally substituted with I to 3 10 groups of C1-6 alkyl, halogen, hydroxyl, (CH2)nCF3,or CN. A further subembodiment of this aspect of formula Ib and Ib 1 is realized when Ra selected from the group consisting of fluorine, chlorine, methyl, ethyl, propyl, butyl, phenyl, tetrazolyl, OH, CN, CF3, and OR 2 , preferably fluorine, chlorine, phenyl, tetrazolyl, methyl, methoxy, OH, and CN. Another subembodiment of the compound of formula lb is realized when n is 0-3, preferably 0-2, 0-1, or 0. Still another 15 subembodiment of the compound of formula Ib is realized when R 2 of formula Ib is hydrogen. Another subembodiment of the compound of formula Ib is realized when R 2 is methyl. Still another aspect of this invention is realized with the compound of structural formula Ic: /R4 (CHR2 )n HN OH 20 -9- WO 2011/043954 PCT/US2010/050493 Ic or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt, wherein R 4 is selected from the group consisting of (CHR 2 )nC5-10 heterocyclyl, (CJ-IR 2 )nC6-10 aryl, (CHR 2 )nC3-10 cycloalkyl, or C1-6 alkyl; said 5 alkyl, cycloalkyl, heterocyclyl and aryl optionally substituted with 1 to 3 groups of Ra. A subembodiment of the compound of formula Ic is realized when R 4 is methyl, ethyl, propyl, or butyl optionally substituted with 1 to 3 groups of Ra. Another subembodiment of the compound of formula Ic is realized when R 4 is cyclobutyl, cyclopropyl, cyclopentyl, or cyclohexyl, all optionally substituted with 1 to 3 groups of Ra and R2 of formula Ic, when present is hydrogen 10 or methyl. Another embodiment of the compound of formula Ic is realized when R 4 is optionally substituted piperonyl, indolyl, pyridyl, imidazolyl, pyrimidinly, quinolinyl, isoquinolinyl, pyranoyl, or naphthyl, and R 2 of formula Ic when present is hydrogen or methyl. For the compounds of the formula Ic, optionally substituted means substituted with 1 to 3 groups of Ra. Another subembodiment of the compound of formula Ic is realized when n is 0-3, 15 preferably 0-2, 0-1 or 0. Still another aspect of this invention is realized with the compound of structural formula Id: HN{CHRinr HN O Id 20 or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt, wherein Ra and n are as originally described herein and R 5 is R 4 or -NR 3 R 4 . A subembodiment of the compound of formula Id is realized when R 5 is R 4 which is selected from the group consisting of C1-6 alkyl, C3-6 cycloalkyl, (CH2)nC5-10 -10- WO 2011/043954 PCT/US2010/050493 heterocyclyl, or (CH2)nC 6-10 aryl, said cycloalkyl, heterocyclyl and aryl optionally substituted with 1 to 3 of Ra. A further subembodiment of the compound of formula Id is realized when R5 is is C1-6 alkyl, (CH2)nphenyl, pyranoyl, or indenyl, said alkyl, phenyl andindeneyl optionally substiututed with 1 to 3 groups of Ra. Another subembodiment of the compound of formula Id 5 is realized when R 5 is -NR 3 R 4 , wherein one of R3 and R 4 is hydrogen and the other is selected from the group consisting of C1-6 alkyl, C3-6 cycloalkyl, (CH2)nC5-10 heterocyclyl, or (CH2)nC6-10 aryl, said cycloalkyl, heterocyclyl and aryl optionally substituted with I to 3 of Ra. A further subembodiment of the compound of formula Id when R 4 is -NR 3 R 4 is realized when one of R 3 and R 4 is hydrogen and the other is C1-6 alkyl, and (CH2)nphenyl, said alkyl, 10 and phenyl optionally substiututed with 1 to 3 groups of Ra. Another subembodiment of the compound of formula Id is realized when Ra is selected from the group consisting of C1 -6 alkyl, halogen, CN, OR, (CH2)nCF3, C3-6 cycloalkyl, (CH2)nC5-10 heterocyclyl, or (CH2)nC6-10 aryl, said heterocyclyl and aryl optionally substituted with 1 to 3 groups of C1 -6 alkyl, halogen, hydroxyl, (CH2)nCF3,or CN. A further subembodiment of this aspect of formula Id is realized 15 when Ra selected from the group consisting of fluorine, chlorine, methyl, ethyl, propyl, butyl, phenyl, tetrazolyl, OH, CN, CF3, and OR2, preferably fluorine, chlorine, phenyl, tetrazolyl, methyl, methoxy, OH, and CN. Another subembodiment of the compound of formula Id is realized when n is 0-3, preferably 0-2, 0-1 or 0. Still another subembodiment of the compound of fonnula Id is realized when R 2 if present, is hydrogen. 20 Another subembodiment of the compound of formula Id is realized when R 2 if present, is methyl. Still another aspect of this invention is realized with the compound of structural formula Ie: - 11 - WO 2011/043954 PCT/US2010/050493 (R')o-3 (CHR2)n HN OH Y W Ie or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt, wherein Ra and n are as described herein, and W is CHR 4 , 5 or -0- and Y is CH2 or -0-, R 4 is selected from the group consisting of H, (CH2)nOR 2 , CH(OR 2 )2, and CH2Si(C5-6 aryl)2R 2 , provided that both Y and W are not -0- at the same time. A subembodiment of the compound of fonnula le is realized when Ra is selected from the group consisting of C1-6 alkyl, halogen, CN, OR 2 , (CH2)nCF3, C3-6 cycloalkyl, (CH2)nC5-10 heterocyclyl, or (CH2)nC6-10 aryl, said heterocyclyl and aryl optionally substituted with 1 to 3 10 groups of C1-6 alkyl, halogen, hydroxyl, (CH2)nCF3,or CN. A further subembodiment of this aspect of formula le is realized when Ra selected from the group consisting of fluorine, chlorine, methyl, ethyl, propyl, butyl, phenyl, tetrazolyl, OH, CN, CF3, and OR 2 , preferably fluorine, chlorine, phenyl, tetrazolyl, methyl, methoxy, OH, and CN. Another subembodiment of the compound of formula le is realized when n is 0-3, preferably 0-2, 0-1 or 0. Still another 15 subembodiment of the compound of formula le is realized when R 2 is hydrogen. Another subembodiment of the compound of formula Ie is realized when R 2 is methyl. Another aspect of this invention is realized with the compound of structural formula If: - 12 - WO 2011/043954 PCT/US2010/050493 (R')o-3 (CHR 2 )n HN OH U I x If or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt,, wherein Ra and n are as described herein, and U, X, and Z 5 are independently selected from CH2 or -0-, provided that only one of U, X, and Z can be -O at any given time. A subembodiment of the compound of formula If is realized when Ra is selected from the group consisting of C1-6 alkyl, halogen, CN, OR 2 , (CH2)nCF3, C3-6 cycloalkyl, (CH2)nC5-10 heterocyclyl, or (CH2)nC6-10 aryl, said heterocyclyl and aryl optionally substituted with I to 3 groups of C1-6 alkyl, halogen, hydroxyl, (CH2)nCF3,or CN. 10 A further subembodiment of this aspect of formula If is realized when Ra selected from the group consisting of fluorine, chlorine, methyl, ethyl, propyl, butyl, phenyl, tetrazolyl, OH, CN, CF3, and OR 2 , preferably fluorine, chlorine, phenyl, tetrazolyl, methyl, methoxy, OH, and CN. Another subembodiment of the compound of formula If is realized when n is 0-3, preferably 0 2, 0-1 or 0. Still another subembodiment of the compound of formula If is realized when R 2 is 15 hydrogen. Another subembodiment of the compound of formula If is realized when R 2 is methyl. Examples of compounds of this invention are found in Tables A and B: - 13 - WO 2011/043954 PCT/US2010/050493 TABLE A COMPOUND COMPOUND (4aR,8aR)-4-[(4- F (4aRSaR)-4-[(3,4- F fluorophenyl)amino]octa HN difluorophenyl)amino F hydronaphthalen-4a(21-H)- ]octahydronaphthalen 0 H H 2,3-dihydro-1H-inden-1- (4aS,8aS)-N-(4 yl[(4aS,8aS)-4-a-hydroxy- fluorophenyl)-4a 4-(phenyl- H hydroxy-4- HO amino)octahydroquinolin (phenylamino)octahy -1(2H)-yl]methanone droquinoline-1(2H) N carboxamide N H H, O 0 NH F (4aS,8aS)-4a-hydroxy-4- [(4aS,8aS)-4a (phenylamino)-N- hydroxy-4 (propan-2- H (phenylamino)octahy HO yl)octahydroquinoline- droquinolin-1(2H) 1(2H)-carboxamide yl](phenyl)methanon IN e IN H, H O NH CH 3 CH 3 -14- WO 2011/043954 PCT/US2010/050493 [(4aS,8aS)-4a-liydroxy-4- (4aS,8aS)-4a (phenylainino)- hydroxy-N-phenyl- 1 octahydroquinolin- 1(21)- HO (3,3,3- HO ylJ(tetrahydro-2H-pyran- trifluoropropanoyl)de 4-yl)methanone cahydroquinolin-4 N aminium IN F trifluoroacetate 0 1-[(4aS,8aS)-4a-hydroxy- 1-4aSa)4a 4- HON hydroxy-4- HON (phenylamino)octahydroq (phenylanino)octahy uinolin-1(2H)-yl]-3- N CH droquinolin-1(2H)- -N methylbutan-1-one o CM, yl]pentan-1-one oC I-[(4aS,8aS)-4a-hydroxy- (4aS,8aS)-1-benzyl- H 4- 4- 0 HN*N (phenylamino)octahydroq HO HN (phenylamino)octahy uinolin- 1(2H)- droquinolin-4a(2H)- N yljethanone ol N H O CHC (4aR,8aR)-4- (4aR,8aR)-4-(propan (cyclopropylamino)octah HN 2- HN 4OH ydronaphthalen-4a(2H)- OH ylamino)octahydrona OH o1 phthalen-4a(2H)-ol - 15 - WO 2011/043954 PCT/US2010/050493 (4aR,8aR)-4-[(2,4,6- (4aR,8aR)-4-[(2,4,5- F trifluorophenyl)amino]oc trifluorophenyl)aminF tahydronaphthalen- HN F o]octahydronaphthale OH HN F OH F 4a(2H)-ol n-4a(2H)-ol F F (4aR,8aR)-4-[(3,4,5- (4aR,8aR)-4-[(2,3,5 F F. trifluorophenyl)amino]oc trifluorophenyl)amin tahydronaphthalen- o]octahydronaphthale 4a(2H)-ol HN F n-4a(2-)-ol OH HN F OH F F (4aR,8aR)-4-[(2,3,4- F F (4aR,8aR)-4-{(3,5 trifluorophenyl)amino]oc difluorophenyl)amino tahydronaphthalen- oH Joctahydronaphthalen oH 4a(2H)-ol -4a(2H)-ol (4aR,8aR)-4-[(3,4- F (4aR,8aR)-4-{(2,6 difluorophenyl)aminojoct difluorophenyl)amino ahydronaphthalen- ol Joctahydronaphthalen 4a(2H)-ol -4a(21H)-ol (4aR,8aR)-4-[(2, 3- F (4aR,SaR)-4-[(4- F difluoropbenyl)amino]oct fluorophenyl)amino] ahydronaphthalen- o. octahydronaphthalen 4a(2H)-ol 4a(2H)-ol - 16- WO 2011/043954 PCT/US2010/050493 (4aR,8aR)-4-[(3- (4aR,8aR)-4-[(2- F fluorophenyl)aminojocta fluorophenyl)amino] hydronaphthalen-4a(2H)- octahydronaphthalen ol 4a(2H)-ol (4aR,8aR)-4-{[4-(1H- HNN (4aR, 8aR)-4-{[3- N=N N HN N tetrazol-5- N (I H-tetrazol-5 yl)phenyl]amino}octabyd HN yl)phenyl]aminoIocta ronaphthalen-4a(2H)-ol hydronaphthalen- H N 4a(2H)-ol (4aR, 8aR)-4-{[2-(IH- NNN 4. tetraol-5-N I tetrazol-5- N (phenylamino)octahy HN yl)phenyl]amino} octahyd H N dronaphthalen ronaphthalen-4a(2H)-ol 4a(2H)-ol H 4-(phenylamino)- (4aR,8aR)-4-(1H- HN octahydronaphthalen- N indol-7-ylamino) 4a(2H)-ol octahydronaphthalen- ON 4a(2H)-ol (4aR,8aR)-4-(biphenyl-4- (4aR,8aR)-4 ylamino)octahydro- (biphenyl-3 naphthalen-4a(2H)-ol ylamino)octahydrona phthalen-4a(2H)-ol - 17 - WO 2011/043954 PCT/US2O1O/050493 ethyl 3-{[(4aR,8aR)-Sa- / (4a.R,8a-R)-4-(1H- /N hydroxydecabydronaphth NHindol-4-ylamino) alen-1 -yI]amino}- 1H- octahydronaphthalen- O indole-2-c~arboxylate o 04a(2fl)-ol (4aR,8aR)-4-(quinolini-8- A(4aJ 8aR-4 ylamino)octahydro- I(isoquinolin-5 naphthalen-4a(2H)-ol HHNylamino)octahydrona phthalen-4a(2TH-oI (4aR,8aR)-4-(quinolin-5- AN(4aR,8aR)-4-N ylanfino)octahydro- (isoquinolin- 1-N naphthalen-4a(2N)-ol 14NN ylamino)octahiydronia IIN N phthalen-4a(2H-o1 (4AR8aR)-4-(quinolin-2- A NaR-4 ylamino)octahydro- N(quinolin-6 naphthalen-4a(2I)-ol HNylamino)octahydrona HJ phthalen-4a(2R)-ol (4aR,8a1)-4-(quinolin-3- A(4aR8aR>4 N ylamino)octahyclro- A(isoquinolin-3 naphthalen-4a(2TH-ol HNNNylamino)octahydrona N N phthialen-4a(2H)-ol (4aR,SaR)-4-[(2, 5- (aa)4 difluorophenyl)amino]oct OH AF(naphthalen-2 ahydronaplithalen- ylamino)ootahydrona HN A 4a(2TH-ol phthalen-4a(211)-ol 0H - 1ID WO 2011/043954 PCT/US2010/050493 (4aR,8aR)-4-(naphthalen- (4aR,8aR)-4 1- N(biphenyl-2 ylamino)ootahydronaphth ylamino)octahydrona alen-4a(2H)-ol phthalen-4a(2H)-ol (4aS,8aR)-4-(morpholin- (4S, 4aS,8aR)-4-{[2- 4- (1H-indol-3 yl)octahydronaphthalen- yl)ethyl]amino} octah 4a(2H)-of ydronaphthalen- NH H -O 4a(2H)-ol H (4R,4aS,8aR)-4-{[2-(]H- (4S, 4aS,8aR)-4-[(2 indol-3- phenylethyl) yl)ethyl]amino} octahydro amino]octahydronaph NH OH naphthalen-4a(2H)-ol NH thalen-4a(2H)-ol H (4R,4aS,8aR)-4-[(2- (4R,4aS,8aR)-4-[(3 phenylethyl)amino]octah chlorophenyl)amino] ydronaphthalen-4a(2H)- NH octahydronaphthalen- O ol 4a(2H)-ol HH (4R,4aS,8aR)-4-[(1,3 - -/-0 (4S,4aS,8aR)-4-[(1,3- /-0 benzodioxol-5- benzodioxol-5 ylmethyl)amino]octahydr ylmethyl)amino onaphthalen-4a(2H)-ol NH }octahydronaphthalen NH I OH.OH -4a(21)-ol H 19H - 19 - WO 2011/043954 PCT/US2O1O/050493 (IR,4aR,SaS)-8a- (1S,4aR,8aS)-Sa hyclroxy-N-( I- Nhydroxy-N-( 1-N phenylethyl)decahydrona e.~N:phenylethyl)decahydr ~ phthal en-I -amirnum onaphthalen- I aminium 0 H H (1R,4aR,8aS)-N-benzyb f I (1S,4aR,8a)-N Sa- benzyl-Sa hydroxydeeahiydro-naphth N:hydroxydecahydrona H ON Op alen- 1-aminlium phthalen- 1-aminiurn N4S8R--34 (4aS,8aR)-4-(pyrid in- A dihydroisoquinolin- 3 2(111>- Nylamino)octahydrona yl)octahiydronaphthalen- phthalen-4a(2H)-olH 4a(21H)-ol (4R,4aS,8aR)-4-(-1,3 - (48,4a8,8aR)-4-( 1,3 benzodioxol-5- ~Ibenzodioxol-5 ylarnino)octahydronaplh ON ylainino)octahydrona 2O alen-4a(2H)-ol phthalen-4a(2H)-oI o H H (4R,4aS,8aR)-4-[(4- A-(48,4aSa)-4-f (4- A methylphenyl)amino]octa NH inethylphenyl)amino] ON OH hydronaphithalen-4a(2H)- octahydronaphthaien ol 4a(211)-ol H H (4S,4a5,SaR)-4-f(3- i 4 8R-[( cI chlorophenyl)aminolocta Nchlorophenyl)aminoJ hydronaphthalen-4a(2H)- z OH octahydronaphthaien ol 4a(2TH-oI C D H H - 20 - WO 2011/043954 PCT/US2010/050493 0 10 (4R,4aS,8aR)-4-[(4- (4S,4aS,8aR)-4-[(4 methoxyphenyl)amino]oc methoxyphenyl)amin OH~ - oil tabydronaphthalen- o]octahydronaphthale 4a(2H)-ol n-4a(2H)-ol H H (4R,4aS,8aR)-4-[(3- OMe (4S,4aS,8aR)-4-[(3- OMe methoxyphenyl)anino]oc methoxyphenyl)amin tahydronaplthalen- o]octahydronaphthale 4a(2h)-ol n-4a(2H)-ol H H (4R,4aS,8aR)-4-[(2- 0*1O- (4S,4aS,8aR)-4-[(2 methoxyphenyl)amino]oc N methoxyphenyl)amin tahydronaphthalen- o]octahydronaphthale 4 a(2H)-ol n-4a(2H)-ol H H 4-{ [(IR,4aR,8aS)-8a- N 4-{[(IS,4aR,8aS)-8a- N hydroxydecahydronaphth hydroxydeca- N alen-1- hydronaphthalen-1- ON yl]amino} benzonitrile yI]arino} benzonitril H e H 3-{[(IR,4aR,8aS)-8a- N3-[(IS,4aR,8aS)-8a- N hydroxydecahydronaphth hydroxydecahydrona alen-1- Nphthalen-1 NH NH yljamino}benzonitrile ox yl]amino}benzonitril oH H _ _ _ _ _H (4R,4aS,8aR)-4- (4S,4aS,8aR)-4 (phenylarnino)octahydron NH (phenylamino)octahy aphthalen-4a(2H)-ol dronaphthalen HD 4a(2H)-ol H H -21- WO 2011/043954 PCT/US2010/050493 (4aR,8aR)-4-(2,3- (4aR,8aR)-4-(2,3 d ihydro- 1 H-inden-2- dihydro-1H-inden-1 ylamino)octahydronaphth * ylamino)oota- CH alen-4a(2H)-ol hydronaphthalen 4a(2H)-ol (4aR,8aR)-4-[(2, 5- (4aR,8aR)-4-[(2 difluorophenyl)amino]oot OH methylpropyl)amino] H ahydronaphthalen- octahydronaphthalen 4a(21H)-ol 4a(2H)-ol (4aR,8aR)-4-(IH-indol-5- NM (4aR,8aR)-4-(pyridin ylamino)octahydro- 4HMM- , naphthalen-4a(2H)-ol amino)octahydronaph thalen-4a(2H)-ol (4S,4aR,8aR)-4- J (4R,4aR,8aR)-4 (tetrahydro-2H-pyran-4- N (tetrahydro2N ylamino)octahydro- pyran-4-ylamino) naphthalen-4a(2H)-ol octahydronaphthalen 4a(2H)-ol (4aR,8aR)-4- (4aR,8aR)-4-(1,2,3,4 (cyclopentylamino)octah 0H tetrahydro ydronaphthalen-4a(2H)- naphthalen-i-yl- MN ol amino)octahydronaph thalen-4a(2H)-ol - 22 - WO 2011/043954 PCT/US2010/050493 (4aR,8aR)-4- {[(1S,2R)-2- (4aR,8aR)-4- 1XN hydroxycyclohexyl- H [(pyrimidin-5 ]amino} octahydronaphth ylmethyl)amino]octa alen-4a(2H)-ol hydronaphthalen 4a(2H)-ol 0 F (4aR,8aR)-4-(tetrahydro- (4aR,8aR)-4-[(2,2,2- F F 2H-pyran-3-ylamino)- trifluoroethyl)amino] octahydro-naphthalen- octahydronaphthalen- OH 4a(2H)-ol 4 a(2H)-ol (4aR,8aR)-4-[(2- (4aR,8aR)-4-[(2 methylcyclohexyl)amino] methoxyethyl)amino] octahydronaphthalen- octahydronaphthalen- O 4a(2H)-ol 4a(2H)-ol (4aR,8aR)-4[(3S,5S,7S) (4aR,8aR)-4-(2,3 tricyclo[3.3.1.1 3 , 7 ]dec-1- dihydro- lH-inden-2 ylamino]octahydro- ON ylamino) naphthalen-4a(2H)-ol octahydronaphthalen 4a(2H)-ol (4aR,8aR)-4-(morpholin- (4aR,8aR)-4-{[2-(1H 4- indol-3 OH yl)octahydronaphthalen- yl)ethyljamino}octah 4a(2H)-ol ydronaphthalen- HN 4a(2H)-ol - 23 - WO 2011/043954 PCT/US2O1O/050493 (4aR,8aR)-4-[(2- 04 a)4[13 phenylethyl)aminoloctah benzodioxol-5 ydronaphthalen-4a(2H)- N ylmethyl)amino]octa ol ~hydronaphthalen- H c ) 4a(2H)-ol (4aR,8aR)-4-[(1- (4aR,8a)-4 phenylethyl)aminojoctah (benzylaminio)octahy ydronaphthialen-4a(2TH- dronaphthalen ol 4a(2Th-ol I4R8R--34 (4aR,Sa)-4-(pyridin dihydroisoquinolin- 3- H 2(111>- N ylainino)octahydrona yI)oeiahiydronaphtlialen- phtlialen-4a(2F-1-oI 4a(2H)-ol (4aR,SaR)-4-(1 ,3- (4aR,SaR)-4- [(4 benzodioxol-5- rnethyiphenyl)arnino] H ylamino)oatahydronaphth OHoctahydronaphthalen alen-4a(2LT)-oI 4a(2H-)-ol (4a.R,SaR)-4-((3- (4ARaR)-4-[(3- cl chlorophenyl)ainino]octa Ichlorophenyl)airninol N hydronaphthalen-4a(211)- octahydronapbthalen ol 4a(2H)-ol (4aR,SaR)-4-[(4- (4aR,8aR)-4-[(3-0 methoxyphenyl)amino]oe mHrethoxyphenyl)amin tahydronaphihalen- o]octahiydronaphthiale N 4a(2TH-ol n-4a(2H)-ol -24 - WO 2011/043954 PCT/US2010/050493 (4aR,8aR)-4-[(2- A 0 4-{[(4aR,8aR)-8a methoxyphenyl)amino]oc hydroxydecahydrona tahydronaphthalen- plithalen-1- *" 4a(2h)-ol yl]amino}benzonitril e 3-{[(4aR,8aR)-8a- 2-{[(4aR,8aR)-Sa hydroxydecahydronaphth hydroxydecahydrona alen-l- phthalen- 1- ON yl]amino} benzonitrile o yl]amino}benzonitril e 4-(phenylamino)- (4aR,5S,8S,8aR)-5- H octahydronaphthalen- H N" [(4-fluorophenyl) 4a(2H)-ol amino]-8-[(2 metboxyethoxy)meth WN yl]hexahydro-2H- F cbromen-4a(SH)-ol or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer, oxidative metabolite or prodrug of the compound or its salt. TABLE B COMPOUND COMPOUND (4aR,5S,8aR)-8-(1,3- (4aS,5R,8aR)-5-[(4- F dioxolan-2-yl)-5-[(4- H fluorophenyl)(methyl)ami N OH 3 fluorophenyl)amino]hexahy no] dro-2H-chromen-4a(5H)-ol HO Hbexahydro-2H-chromen o HO F 4 a (5 H )-o l -25- WO 2011/043954 PCT/US2010/050493 (4aS,5R,8aR)-5-{(3,4- F (4aS,5R,8aR)-5 difluorophenyl)amino]hexa F N (phenylainino)hexahydro- N %H hydro-2H-chromen-4a(5H)- 2H-chrornen-4a(5H)-o[ (4aR,5S,8aR)-5-[(4- F H (4aR,SS,8aR)-5-[(3,4- F A fluorophenyl)(methyl)amin HN difluorophenyi)aminojhex F H N'OH dilorpeylaHo~e o]hexahydro-2H-chromen- ahydro-2H-chromen 4a(5H)-ol H 0 4a(5H)-ol A0 (4aR,5S,8aR)-5- (4aR,5R,8aR)-8- CH CH3 (phenylamino)hexahydro- bH (dimethoxyniethiyl)-5-[(4- 0 2H-chromen-4a(5H)-ol fluorophenyl)anino]hexah H O ydro-2H-chromen-4a(5H)- HO HN olF (4aS,5R,8aS)-5-[(4- F (4aR,5S,8aS)-5-[(4- F fluorophenyl)amino]hexahy NHOH fluorophenyl)amino]hexah NHOH dro-2H-ehromen-4a(5H)-ol ydro-2H-chromen-4a(5H) Hl O (4aR,5S,8aR)-N-(4- CHF (4aR,5S, 8aR)-5-[(4- F fluorophenyl)-4a-methoxy- C fluorophenyi)(methyl)ami CH N F 8-(methoxy-methyl)-N- no}-8-(methoxy methyl-octahydro-2H- o methyl)hexahydro-2H- 0 HH chromen-5-amine CH, chromen-4a(5H)-ol H O.H (4aR,5S)-5-[(3,4- F (4aR,5S)-4a-methoxy-8 difluorophenyl)amnino]-8- HN 'N F (methoxymethyl)-N- CH3HN (nethoxymethyl)hexahydro HQ phenyloctahydro-2H -2H-chromen-4a(5H)-ol 0 chromen-5-amine 0 'CH3 O'CH 3 - 26 - WO 2011/043954 PCT/US2010/050493 (4aR,5S)-8- (4aR,5S)-N-(4- F (methoxymethyl)-5-H fluoropbenyl)-4a-nethoxy- OH HN (phenylamino)hexahydro- ~ 8-(methoxy 2H-chromen-4a(5H)-ol 0 inethyl)octahydro-2H O' chromen-5-amine O CH 3 (4aR,5S)-5-[(4- F (4aR,5S)-5-[(3,4- F fluorophenyl)(methyl)amin H 3 CN difluorophenyl)aninoj-8- HN F HO HO o]-8-(hydroxymethyl)- ' (hydroxymethyl) hexahydroK2H-chromen- .hexahydro-2H-chromen 4a(5H)-ol OH 4a(5H)-ol (4aR,5S)-8- (4aR,5S)-8-({ [tert-butyl- F (hydroxymethyl)-5- Hg HN (diphenyl)silyl]oxy}methy H N (phenylamino)hexahydro- 1)-5-[(4-fluorophenyl- HO 2H-chromen-4a(5H)-ol 0 )amino]hexahydro-2H- 0 OH chromen-4a(5H)-ol C H H 3 (4aR,5S)-5-[(4- F (4aR,5S)-8-({[tert- H3C F fluorophenyl)amino]-8- HN "N butyl(diphenyl)silyl]oxy} HQN (methoxymethyl)hexahydro Hmethyl)-5-[(4-0 -2H-chromen-4a(5H)-ol fluorophenyl)aminojhexah O'CH3 ydro-2H-chromen-4a(5H)- K i (4aR,5S)-8-({[tert- F (4aR,5S)-8-({[tert butyl(diphenyl)silylloxy}m HN F butyl(diphenyl)silyl]oxy} H g HN ethyl)-5-[(3,4- H methyl)-5 difluorophenyl)aminojhexa o (phenylamino)hexahydro- Q hydro-2H-chromen-4a(5H)- / 21-chromen-4a(5H)-ol 0 ol / CH RHa CH27H -27- WO 2011/043954 PCT/US2010/050493 (4aR,5S)-5-[(4- F (4aR,5S)-S-({[tert- F fluorophenyl)amino]-8- HO HN butyl(diphenyl)silyl]oxy} HO HN'N (hydroxymethyl)hexahydro methyl)-5-[(4 -2H-chrornen-4a(5H)-ol 0 fluorophenyl)amino]hexah - OH ydro-2H-chromen-4a(5H)- .Si-G3 ol 7 CH 3 H 3 H (4R,4aR,8aR)-4-[(4- OH N (4aR,5R,8aS)-5- H fluorophenyl)(methyl)amin " F (phenylamino)octahydro- OH o]octahydro-4aH- 4aH-isochromen-4a-ol 0 isochromen-4a-ol H H FH (4aR,5R,8aS)-5-[(3,4- O H (4aR,5R,8aS)-5-[(4- 0H difluorophenyl)aminolocta / F fluoropFeiy1)amino]octa ' F hydro-4aH-isochromen-4a- ydro-4aH-isoclromien-4a- 013 ol ol (4R,4aR,8aR)-4-[(3,4- OH HpF (4R,4aR,8aR)-4- OH difluorophenyl)amino]octa F (phenylamino)octahydro hydro-4aH-isochromen-4a- 4aH-isochromen-4a-ol 0 olH H CH 3 (4R,4aR,8aR)-4-[(4- OH . (4R,4aS,8aS)-4-[(4 fluorophenyl)anino]octahy / F flUOrophenyl)(methyl)ami OH N F dro-4aH-isochromen-4a-ol no]hexahydro-2H chromen-4a(5H)-ol (4R,4aS,8aS)-4-[(3,4- OH H (4R,4aS,8aS)-4- OH difluorophenyl)amino]hexa /F (phenylamino)hexahydro hydro-2H-chromen-4a(5H)- 2H-chromen-4a(5H)-ol ol H H H . (4R,4aS,8aS)-4-[(4- OH N (4S,4aR,8aS)-4-(4- OH H fluorophenyl)amino]hexahy fluorobenzyl)hexahydro- F dro-2H-chromen-4a(5H)-ol R 2H-chromen-4a(5H)-ol - 28 - WO 2011/043954 PCT/US2010/050493 (4aS,8R,8aR)-8-[(4- F F HN F (4aS,8R,8aR)-8-[(3,4- HN F fluorophenyl)amino]hexahy HO difluorophenyl)aninojhex HO F dro-lH-isochromen- ahydro-l-isochromen 8a(3H)-ol 8a(3H)-ol (4aS,8S,8aS)-8-[(4- F F-8-(3,4- F fluorophenyl)aminohexahy H difluorophenyj)a1nino]hex H F dro-1H-isocbromen- ahydro-IH-isochromen- 0 8a(3H)-ol H 8a(3H)-ol benzyl (4aR,5S,8S,8aR)-8- H ethyl({(4aR,5S,8S,8aR)-5- N [(ethylamino)rnethy]J-5- 0 H [(4-fluorophenyl)-amino]- H [(4-fluorophenyl) 4a-hydroxy-octahydro-2H- amino]hexahydro-2H- H N N chromen-8- HO chromen-4a(5H)-ol HNN F yl}methyl)carbamate (4aS,5R,8S,8aR)-8- N-ethyl-N- o [(diethylamino)methyl]-5- H ({(4aS,5R,8S,8aR)-5-[(4- N [(4- fluorophenyl)amino)-4a- 0 H fluorophenyl)amino]hexahy hydroxyoctahydro-2H dro-2H-chromen-4a(5H)-ol HO HN chromen-8-yl} methyl)-2 F methylpropanamide -aF 1-ethyl-- (4aR,5S,8S,8aR)-8- 0 ({(4aS,5R,8S,8aR)-5-[(4- N [(benzyloxy)methyl]-5-[(4- H fluorophenyl)amino]-4a- 0 H fluorophenyl) hydroxyoctahydro-2H- amino]hexahydro-2H- HO chromen-8-yl}methyl)-3,3- C chromen-4a(5H)-ol H N dimethylurea H or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer, oxidative metabolite or prodrug of the compound or its salt. - 29 - WO 2011/043954 PCT/US2010/050493 The compounds of the present invention may have asymmetric centers, chiral axes and chiral planes, and occur as racemates, racemic mixtures, and as individual diastereomers, with all possible isomers, including optical isomers, being included in the present invention. (See E.L. Eliel and S.H. Wilen Stereochemistry of Carbon Compounds (John Wiley 5 and Sons, New York 1994), in particular pages 1119-1190). In the compounds of generic Formula I, the atoms may exhibit their natural isotopic abundances, or one or more of the atoms may be artificially enriched in a particular isotope having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number predominantly found in nature. The present invention is meant to include 10 all suitable isotopic variations of the compounds of generic Formula I. For example, different isotopic forms of hydrogen (H) include protium (1H) and deuterium (2H). Protium is the predominant hydrogen isotope found in nature. Enriching for deuterium may afford certain therapeutic advantages, such as increasing in vivo half-life or reducing dosage requirements, or may provide a compound useful as a standard for characterization of biological samples. 15 Isotopically-enriched compounds within generic Formula I can be prepared without undue experimentation by conventional techniques well known to those skilled in the art or by processes analogous to those described in the Schemes and Examples herein using appropriate isotopically-enriched reagents and/or intermediates. 20 When any variable (e.g. aryl, heterocycle, RIa, R 6 etc.) occurs more than one time in any constituent, its definition on each occurrence is independent at every other occurrence. Also, combinations of substituents/or variables are permissible only if such combinations result in stable compounds. In addition, the compounds disclosed herein may exist as tautomers and 25 both tautomeric forms are intended to be encompassed by the scope of the invention, even though only one tautomeric structure is depicted. For example, any claim to compound A below is understood to include tautomeric structure B, and vice versa, as well as mixtures thereof -30- WO 2011/043954 PCT/US2010/050493 R R N 0 OH R I R H A B As used herein, "alkyl" is intended to include both branched and straight-chain 5 saturated aliphatic hydrocarbon groups having the specified number of carbon atoms; "alkoxy" represents an alkyl group of indicated number of carbon atoms attached- through an oxygen bridge. "Halogen" or "halo" as used herein means fluoro, chloro, bromo and iodo. Preferably, alkenyl is C2-C6 alkenyl. Preferably, alkynyl is C2-C6 alkynyl. 10 As used herein, "cycloalkyl" is intended to include cyclic saturated aliphatic hydrocarbon groups having the specified number of carbon atoms. Preferably, cycloalkyl is C3 C 10 cycloalkyl. Examples of such cycloalkyl elements include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl and cycloheptyl. As used herein, "aryl" is intended to mean any stable monocyclic or bicyclic 15 carbon ring of up to 7 members in each ring, wherein at least one ring is aromatic. Examples of such aryl elements include phenyl, naphthyl, tetrahydronaphthyl, indanyl, biphenyl, phenanthryl, anthryl or acenaphthyl. The term heterocyclyl, heterocycle or heterocyclic, as used herein, represents a stable 5- to 7-membered monocyclic or stable 8- to 11-membered bicyclic heterocyclic ring 20 which is either saturated or unsaturated, and which consists of carbon atoms and from one to four heteroatoms selected from the group consisting of N, 0, and S, and including any bicyclic group in which any of the above-defined heterocyclic rings is fused to a benzene ring. The heterocyclic ring may be attached at any heteroatom or carbon atom which results in the creation of a stable structure. The term heterocyclyl, heterocycle or heterocyclic includes heteroaryl moieties. 25 Examples of such heterocyclic elements include, but are not limited to, azepinyl, benzodioxolyl, benzimidazolyl, benzisoxazolyl, benzofurazanyl, benzopyranyl, benzothiopyranyl, benzofuryl, -31- WO 2011/043954 PCT/US2010/050493 benzothiazolyl, benzothienyl, benzotriazolyly, benzoxazolyl, chromanyl, cinnolinyl, dihydrobenzofuryl, dihydrobenzothienyl, dihydrobenzothiopyranyl, dihydrobenzothiopyranyl sulfone, 1,3-dioxolanyl, furyl, imidazolidinyl, imidazolinyl, imidazolyl, indolinyl, indolyl, isochromanyl, isoindolinyl, isoquinolinyl, isothiazolidinyl, isothiazolyl, isothiazolidinyl, 5 morpholinyl, naphthyridinyl, oxadiazolyl, 2-oxoazepinyl, oxazolyl, 2-oxopiperazinyl, 2 oxopiperdinyl, 2-oxopyrrolidinyl, piperidyl, piperazinyl, pyridyl, pyrazinyl, pyrazolidinyl, pyrazolyl, pyrazolopyridinyl, pyridazinyl, pyrimidinyl, pyrrolidinyl, pyrrolyl, quinazolinyl, quinolinyl, quinoxalinyl, tetrahydrofuryl, tetrahydroisoquinolinyl, tetrahydroquinolinyl, thiamorpholinyl, thiamorpholinyl sulfoxide, thiazolyl, thiazolinyl, thienofuryl, thienothienyl, 10 thienyl, and triazolyl. An embodiment of the examples of such heterocyclic elements include, but are not limited to, azepinyl, benzimidazolyl, benzisoxazolyl, benzofurazanyl, benzopyranyl, benzothiopyranyl, benzofuryl, benzothiazolyl, benzothienyl, benzoxazolyl, chromanyl, cinnolinyl, dihydrobenzofuryl, dihydrobenzothienyl, dihydrobenzothiopyranyl, dihydrobenzothiopyranyl sulfone, furyl, imidazolidinyl, imidazolinyl, imidazolyl, indolinyl, 15 indolyl, isochromanyl, isoindolinyl, isoquinolinyl, isothiazolidinyl, isothiazolyl, isothiazolidinyl, morpholinyl, naphthyridinyl, oxadiazolyl, 2-oxoazepinyl, oxazolyl, 2-oxopiperazinyl, 2 oxopiperdinyl, 2-oxopyrrolidinyl, piperidyl, piperazinyl, pyridyl, 2-pyridinonyl, pyrazinyl, pyrazolidinyl, pyrazolyl, pyridazinyl, pyrimidinyl, pyrrolidinyl, pyrrolyl, quinazolinyl, quinolinyl, quinoxalinyl, tetrahydrofuryl, tetrahydroisoquinolinyl, tetrahydroquinolinyl, thiamorpholinyl, 20 thiamorpholinyl sulfoxide, thiazolyl, thiazolinyl, thienofuryl, thienothienyl, thienyl and triazolyl. Preferably, heterocycle is selected from 2-azepinonyl, benzimidazolyl, 2 diazapinonyl, imidazolyl, 2-imidazolidinonyl, indolyl, isoquinolinyl, morpholinyl, piperidyl, piperazinyl, pyridyl, pyrrolidinyl, 2-piperidinonyl, 2-pyrimidinonyl, 2-pyrollidinonyl, quinolinyl, tetrahydrofuryl, tetrahydroisoquinolinyl, thienyl and triazolyl. 25 As used herein, "heteroaryl" is intended to mean any stable monocyclic or bicyclic carbon ring of up to 7 members in each ring, wherein at least one ring is aromatic and wherein from one to four carbon atoms are replaced by heteroatoms selected from the group consisting of N, 0, and S. Examples of such heterocyclic elements include, but are not limited to, benzimidazolyl, benzisoxazolyl, benzofurazanyl, benzopyranyl, benzothiopyranyl, benzofuryl, 30 benzothiazolyl, benzothienyl, benzoxazolyl, chromanyl, cinnolinyl, dihydrobenzofuryl, -32- WO 2011/043954 PCT/US2010/050493 dihydrobenzothienyl, dihydrobenzothiopyranyl, dihydrobenzothiopyranyl sulfone, furyl, imidazolyl, indolinyl, indolyl, isochromanyl, isoindolinyl, isoquinolinyl, isothiazolyl, naphthyridinyl, oxadiazolyl, pyridyl, pyrazinyl, pyrazolyl, pyridazinyl, pyrimidinyl, pyrrolyl, quinazolinyl, quinolinyl, quinoxalinyl, tetrahydroisoquinolinyl, tetrahydroquinolinyl, thiazolyl, 5 thienofuhryl, thienothienyl, thienyl and triazolyl. As used herein, unless otherwise specifically defined, substituted alkyl, substituted cycloalkyl, substituted aroyl, substituted aryl, substituted heteroaroyl, substituted heteroaryl, substituted arylsulfonyl, substituted heteroaryl-sulfonyl and substituted heterocycle include moieties containing from 1 to 3 substituents in addition to the point of attachment to the 10 rest of the compound. Preferably, such substituents are selected from the group which includes but is not limited to F, Cl, Br, CF 3 , NH 2 , N(CI-C 6 alkyl) 2 , NO 2 , CN, (C 1 -C 6 alkyl)O-, (aryl)O-, -OH, (C I-C6 alkyl)S(O)m-, (C I-C6 alkyl)C(O)NH-, H2N-C(NH)-, (C I-C6 alkyl)C(O)-, (C I -C6 alkyl)OC(O)-, (C 1 -C 6 alkyl)OC(O)NH-, phenyl, pyridyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, thienyl, furyl, isothiazolyl and CI-C 20 alkyl. 15 As used herein "low enough pyrogen activity" with reference to a pharmaceutical preparation, refers to a preparation that does not contain a pyrogen in an amount that would lead to an adverse effect (e.g., irritation, fever, inflammation, diarrhea, respiratory distress, endotoxic shock, etc.) in a subject to which the preparation has been administered. For example, the term is meant to encompass preparations that are free of, or substantially free of, an endotoxin such as, 20 for example, a lipopolysaccharide(LPS). As used herein "antagonist" and "inhibitor" are used interchangeably to refer to an agent that decreases or suppresses a biological activity, such as to repress an activity of an ion channel, such as TRPA1. TRPA1 inhibitors include inhibitors having any combination of the structural and/or functional properties disclosed herein. 25 A used herein "effective amount" of, e.g., a TRPAI antagonist, with respect to the subject methods of inhibition or treatment, refers to an amount of the antagonist in a preparation which, when applied as part of a desired dosage regimen brings about a desired clinical or functional result. Without being bound by theory, an effective amount of a TRPAI antagonist for use in the methods of the present invention, includes an amount of a TRPAI 30 antagonist effective to decrease one or more in vitro or in vivo function of a TRPAl channel. Exemplary functions include, but are not limited to, membrane polarization (e.g., an antagonist may promote hyperpolarization of a cell), ion flux, ion concentration in a cell, outward current, -33- WO 2011/043954 PCT/US2010/050493 and inward current. Compounds that antagonize TRPAl function include compounds that antagonize an in vitro or in vivo functional activity of TRPA1. When a particular functional activity is only readily observable in an in vitro assay, the ability of a compound to inhibit TRPA1 function in that in vitro assay serves as a reasonable proxy for the activity of that 5 compound. In certain embodiments, an effective amount is an amount sufficient to inhibit a TRPAI -mediated current and/or the amount sufficient to inhibit TRPAI mediated ion flux. As used herein "preventing" is art-recognized, and when used in relation to a condition, such as a local recurrence (e.g., pain), a disease such as cancer, a syndrome complex such as heart failure or any other medical condition, is well understood in the art, and includes 10 administration of a composition which reduces the frequency of, or delays the onset of, symptoms of a medical -condition in a subject relative to a subject which does not receive the composition. Thus, prevention of cancer includes, for example, reducing the number of detectable cancerous growths in a population of patients receiving a prophylactic treatment relative to-an untreated control population, and/or delaying the appearance of detectable 15 cancerous growths in a treated population versus an untreated control population, e.g., by a statistically and/or clinically significant amount. Prevention of an infection includes, for example, reducing the number of diagnoses of the infection in a treated population versus an untreated control population, and/or delaying the onset of symptoms of the infection in a treated population versus an untreated control population. Prevention of pain includes, for example, 20 reducing the magnitude of, or alternatively delaying, pain sensations experienced by subjects in a treated population versus an untreated control population. As used herein "prodrug" is intended to encompass compounds that, under physiological conditions, are converted into the therapeutically active agents of the present invention. A common method for making a prodrug is to include selected moieties that are hydrolyzed under 25 physiological conditions to reveal the desired molecule. In other embodiments, the prodrug is converted by an enzymatic activity of the host animal. For use in medicine, the salts of the compounds of formula I will be pharmaceutically acceptable salts. Other salts may, however, be useful in the preparation of 30 the compounds according to the invention or of their pharmaceutically acceptable salts. When the compound of the present invention is acidic, suitable "pharmaceutically acceptable salts" refers to salts prepared form pharmaceutically acceptable non-toxic bases including inorganic bases and organic bases. Salts derived from inorganic bases include aluminum, ammonium, calcium, copper, ferric, ferrous, lithium, magnesium, manganic salts, manganous, potassium, - 34 - WO 2011/043954 PCT/US2010/050493 sodium, zinc and the like. Particularly preferred are the ammonium, calcium, magnesium, potassium and sodium salts. Salts derived from pharmaceutically acceptable organic non toxic bases include salts of primary, secondary and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, 5 such as arginine, betaine caffeine, choline, N,N 1 -dibenzylethylenediamine, diethylamin, 2 diethylaminoethanol, 2-dimethylaminoethanol, ethanolamine, ethylenediamine, N ethylmorpholine, N-ethylpiperidine, glucamine, glucosamine, histidine, hydrabamine, isopropylamine, lysine, methylglucamine, morpholine, piperazine, piperidine, polyamine resins, procaine, purines, theobromine, triethylamine, trimethylamine tripropylamine, 10 tromethamine and the like. When the compound of the present invention is basic, salts may be prepared from pharmaceutically acceptable non-toxic acids, including inorganic and organic acids. Such acids include acetic, benzenesulfonic, benzoic, camphorsulfonic, citric, ethanesulfonic, fumaric, gluconic, glutamic, hydrobromic, hydrochloric, isethionic, lactic, maleic, malic, mandelic, 15 methanesulfonic, mucic, nitric, pamoic, pantothenic, phosphoric, succinic, sulfuric, trifluoro acetic, tartaric, p-toluenesulfonic acid and the like. Particularly preferred are citric, hydrobromic, hydrochloric, maleic, phosphoric, sulfuric and tartaric acids. The preparation of the pharmaceutically acceptable salts described above and other typical pharmaceutically acceptable salts is more fully described by Berg et al, "Pharmaceutical 20 Salts," J Pharm. Sei., 1977:66:1-19. This invention further relates to a pharmaceutical composition formulated for administration in a human patient, or for veterinary use, comprising an effective amount of at least one compound of formula I or a salt thereof, or a solvate, hydrate, stereoisomer, enantiomer, oxidative metabolite or prodrug of the compound or its salt, and one or more pharmaceutically 25 acceptable carriers. It certain aspects the compound included in the pharmaceutical composition may be active itself, or may be a prodrug, e.g., capable of being converted to an active compound in a physiological setting. The composition may comprise, but is not limited to, one or more buffering agents, wetting agents, emulsifiers, suspending agents, lubricants, adsorbents, surfactants, 30 preservatives and the like. The composition may be formulated as a solid, liquid, gel, -35- WO 2011/043954 PCT/US2010/050493 ointment, or suspension for oral administration (e.g., drench, bolus, tablet, powder, capsule, mouth spray, emulsion); parenteral administration (e.g., subcutaneous, intramuscular, intraarterially, intrathecally, intracapsularly, intraorbitally, intracardiacly, intradermally, intraperitoneally, intraspinally, intravenous, epidural injection); topical application (e.g., 5 cream, ointment, controlled-released patch, spray); intravaginal, intrarectal, transdermal, ocular, or nasal administration, or by inhalation. Thus, an aspect of this invention is a TRPA1 antagonist that is administered topically. Another aspect of this invention is a TRPA 1 antagonist that is administered orally. Another aspect of this invention is a TRPA 1 antagonist that is administered parentally. 10 When the compounds of the present invention are administered as pharmaceuticals, to humans and animals, they can be given per se or as a pharmaceutical composition containing, for example, 0.1 to 99.5% (more preferably, 0.5 to 90%) of active ingredient in combination with a pharmaceutically acceptable carrier. 15 The selected dosage level will depend upon a variety of factors including the activity of the particular compound of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compound employed, the age, sex, weight, 20 condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts. A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the compounds of the invention employed in the 25 pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved. In general, a suitable daily dose of a compound of the invention will be that amount of the compound that is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above. Generally, intravenous, 30 intracerebroventricular and subcutaneous doses of the compounds of this invention for a patient will range from about 0.0001 to about 100 mg per kilogram of body weight per day. If desired, the effective daily dose of the active compound may be administered as two, three, four, five, six or more sub-doses administered separately, at appropriate intervals throughout the day, optionally, in unit dosage forms. -36- WO 2011/043954 PCT/US2010/050493 In certain embodiments, the pharmaceutical compositions may be for use in treating or preventing a condition involving activation of TRPAI or for which reduced TRPAI activity can reduce the severity. In certain embodiments, the pharmaceutical compositions have a low enough pyrogen activity to be suitable for use in a human patient, or for 5 veterinary use. In certain aspects, a compound of the invention is combined with one or more of an analgesic, which includes, but is not limited to, opioids, glucocorticosteroids, non-steroidal anti inflammatories, naphthylalkanones, oxicams, para-aminophenol derivatives, propionic acids, propionic acid derivatives, salicylates, fenamates, fenamate derivatives, pyrozoles, and pyrozole 10 derivatives. Examples of such analgesic compounds include, but are not limited to, codeine, hydrocodone, hydromorphone, levorphamol, morphine, oxycodone, oxymorphone, butorphanol, dezocine, nalbuphine, pentazocine, etodolac, indomethacin, sulindae, tolmetin, nabumetone, piroxicam, acetaminophen, fenoprofen, flurbiprofen, ibuprofen, ketoprofen, naproxen, diclofenac, oxaprozin, aspirin, diflunisal, meclofenamic acid; mefanamic acid, prednisolone, and 15 dexamethasone. Preferred analgesics are non-steroidal anti-inflammatories and opioids (preferably morphine). In certain aspects, a compound of the invention is combined with one or more of a non-steroidal anti inflammatory, which includes, but is not limited to, piroxicam, diclofenac, etodolac, indomethacin, ketoralac, oxaprozin, tolmetin, naproxen, flubiprofen, 20 fenoprofen, ketoprofen, ibuprofen, mefenamic acid, sulindac, apazone, phenylbutazone, aspirin, celecoxib and rofecoxib. In certain aspects, a compound of the invention is combined with one or more of an antiviral agent which includes, but is not limited to amantadine, acyclovir, cidofovir, desciclovir, deoxyacyclovir, famciclovir, foscamet, ganciclovir, penciclovir, azidouridine, anasmycin, 25 amantadine, bromovinyldeoxusidine,chlorovinyldeoxusidine, eytarbine,didanosine, deoxynojirimycin, dideoxycitidine, dideoxyinosine, dideoxynucleoside, edoxuidine,. enviroxime, f acitabine, foscamet, fialuridine, fluorothymidine, floxuridine,' hypericin, interferon, interleukin, isethionate, nevirapine, pentanidine, ribavirin, rimantadine, stavirdine, sargramostin, suramin, trichosanthin, tribromothymidine, trichlorothymidine, vidarabine, 30 zidoviridine, zalcitabine 3-azido-3-deoxythymidine, 2',3'-dideoxyadenosine (ddA), 2',3' dideoxyguanosine (ddG), 2',3'-dideoxycytidine (ddC), 2',3'-dideoxythymidine (ddT), 2'3' dideoxy-dideoxythymidine (d4T), 2'deoxy-3'-thia-cytosine (3TC or lamivudime), 2',3'-dideoxy 2'-fluoroadenosine, 2',3'did eoxy-2'-fluoroinosine, 2',3'-dideoxy-2'-fluorothymidine, 2',3' dideoxy-2' fluorocytosine, 2'3'-dideoxy-2',3'-didehydro-2'-fluorothymidine (Fd4T), 2'3'dideoxy 35 2'-beta-fluoroadenosine (F-ddA), 2'3'-dideoxy-2'-beta-fluoro-inosine (Fddl), and 2',3'-dideoxy-2' -37- WO 2011/043954 PCT/US2010/050493 beta-flurocytosine (F-ddC), trisodium phosphomonoformate, trifluorothymidine, 3'azido 3thymidine (AZT), dideoxyinosine (ddl), and idoxuridine. In certain aspects, a compound of the invention is combined with one or more of an antibacterial agent which includes, but is not limited to, amanfadine hydrochloride, 5 amanfadine sulfate, amikacin, amikacin sulfate, amoglycosides, amoxicillin, ampicillin, amsamycins, bacitracin, beta-lactams, candicidin, capreomycin, carbenicillin, cephalexin, cephaloridine, cephalothin, cefazolin, cephapirin, cephradine, cephaloglycin, chilomphenicols, chlorhexidine, chloshexidine gluconate, chlorhexidine hydrochloride, chloroxine, chlorquiraldol, chlortetracycline, chlortetracycline hydrochloride, ciprofloxacin, circulin, clindamycin, 10 clindamycin hydrochloride, clotrimazole, cloxacillin, demeclocycline, diclosxacillin, diiodohydroxyquin, doxycycline, ethambutol,. ethambutol hydrochloride, erythromycin, erythromycin estolate, erhmycin stearate, famesol, floxacillin, gentamicin, gentamicin sulfate, gramicidin, giseofulvin, haloprogin, haloquinol ,hexachlorophene, iminocyleline, iodochlorhydroxyquin, kanamycin, kanamycin sulfate, lincomycin, lineomycin, lineomycin 15 hydrochoride, macrolides, meclocycline, methacycline, methacycline hydrochloride, methenine, methenamine hippurate, methenamine mandelate, methicillin, metonidazole, miconazole, miconazole hydrochloride, minocycline, minocycline hydrochloride, mupirocin, nafeillin, neomycin, neomycin sulfate, netimicin, netilmicin sulfate, nitrofarazone, norfloxacin, nystatin, octopirox, oleandomycin, orcephalosporins, oxacillin, oxyteacline, oxytetracycline 20 hydrochloride, parachlorometa xylenol, paromomycin, paromomycin sulfate, penicillins, penicillin G, penicillin V, pentamidine, pentamidine hydrochloride, phenethicillin, polymyxins, quinolones, streptomycin sulfate, tetracycline, tobramycin, tolnaftate, triclosan, trifampin, rifamycin, rolitetracycline, spectinomycin, spiramycin, struptomycin, sulfonamide, tetracyclines, tetracycline, tobramycin, tobramycin sulfate, triclocarbon, triclosan, trimethoprim 25 sulfamethoxazole, tylosin, vancomycin, and yrothricin. In certain aspects, a compound of the invention is combined with one or more of a cough suppressant, decongestant, or expectorant. In certain aspects, a TRPAl inhibitor of formula I can be used to reduce the pain and/or inflammatory effect of a retinoid by combining a retinoid with the subject TRPAI inhibitor. 30 Retinoids include, but are not limited to, compounds such as retinoic acid (both cis and trans), retinol, adapalene, vitamin A and tazarotene. Retinoids are useful in treating acne, psoriasis, rosacea, wrinkles and skin cancers and cancer precursors such as melanoma and actinic keratosis. -38 - WO 2011/043954 PCT/US2010/050493 In other aspects, the TRPAI inhibitors of formula I can be combined with keratolytic agents, which include benzoyl peroxide, alpha hydroxyacids, fruit acids, glycolic acid, salicylic acid, azelaic acid, trichloroacetic acid, lactic acid and piroctone. The TRPAI inhibitors of formula I can also be combined with depilatory agents 5 (hair loss), anti-acne agents, anti-eczema agents and anti-psoratic agents. Compounds particlarly useful in treating acne include azelaic acid (an aliphatic diacid with antiacne properties), anthralin (a diphenolic compound with antifungal and antipsoriatic properties), and masoprocol (nordihydroguaiaretic acid, a tetraphenolic compound with antioxidant properties, also useful in the treatment of actinic keratosis) and analogs thereof (such as austrobailignan 6, 10 oxoaustrobailignan 6, 4'-O-methyl-7,7'-dioxoaustrobailignan 6, macelignan, demethyldihydroguaiaretic acid, 3,3',4-trihydroxy-4'-methoxylignan, . Saururenin, 4-hydroxy 3,3',4'-trimethoxylignan, and isoanwulignan). Anti-eczema agents include ,pimecrolimus and tacrolimus. Anti-psoriatic active agents suitable for use in the present invention include retinoids (including isomers and derivatives of retinoic acid, as well as other compounds that bind to the 15 retinoic acid receptor, such as retinoic acid, acitretin, 13-cis-retinoic acid (isotretinoin), 9-cis retinoic acid, tocopheryl-retinoate (tocopheirol ester of retinoic acid (trans- or cis-)), etretinate, motretinide, 1-(13-cis-retinoyloxy)-2-propanone, 1-(13-cis-retinoyloxy)-3decanoyloxy-2 propanone, 1,3-bis-(13-cis-retinoyloxy)-2-propanone, 2-(13-cisretinoyloxy)-acetophenone, 13 cis-retinoyloxymethyl-2,2-dimethyl propanoate, 2(13-cis-retinoyloxy)-n-methyl-acetamide, I 20 (13-cis-retinoyloxy)-3-hydroxy-2propanone, 1-(13-cis-retinoyloxy)-2,3-dioleoylpropanone, succinimdyl 13-cis retinoate, adapalene, and tazarotene), salicylic acid (monoammonium salt), anthralin, 6-azauridine, vitamin D derivatives (including but not limited to Rocaltrol (Roche Laboratories), EB 1089 (24a,26a,27a-trihomo-22,24-diene-I a,25-(OH)2 D3), KH 1060 (20-epi-22-oxa-24a.26a,27a-trihomo-la,25-(OH)2-D3), MC 1288, GS 1558, CB 25 1093, 1,25-(OH)2-16-ene-D3, 1,25-(OH)2-16-ene-23-yne-D3, and 25(OH)2-16-ene-23-yne-D3, 22-oxacalcitriol; Ia-(OH)D5 (University of Illinois), ZK 161422 and ZK 157202 (Institute of Medical Chemistry-Schering AG), alfacalcidol, calcifediol, calcipotriol (calcipotriene), maxacalcitriol, colecalciferol, doxercalciferol, ergocalciferol, falecalcitriol, lexacalcitol, maxacalcitol, paricalcitol, secalciferol, seocalcitol, tacalcitol, calcipotriene, calcitriol, and other 30 analogs as disclosed in U.S. Patent No. 5,994,332), pyrogallol, and tacalcitol. The compounds of formula I can also be combined with vitamins and derivatives thereof including Vitamin A, ascorbic acid (Vitamin C), alphatocopherol (Vitamin E), 7 dehydrocholesterol (Vitamin D), Vitamin K, alpha-lipoic acid, lipid soluble anti-oxidants, and -39- WO 2011/043954 PCT/US2010/050493 the like. The subject TRPAI inhibitors can also be used with skin protectants, such allantoin and esculin. When two or more compounds of the invention are combined the two or more compounds may have a similar selectivity profile and functional activity, or they may have a 5 different selectivity profile and functional activity. By way of example, the two or more compounds may both be approximately 10, 100, or 1000, fold selective for antagonizing a function of TRPA1 over TRPV, TRPV5, and TRPV6 (e.g., the two or more compounds have a similar selectivity profile), and further may inhibit a function of TRPAI with a similar IC50 (e.g., a similar functional activity). Alternatively, the one of the two or more compounds may 10 selectively inliibit-TRPAI while the other of the two or more compounds inhibits both TRPAI and TRPV 1 (e.g., the two or more compounds have differing selectivity profiles). Administration of combinations of two or more compounds of the invention having similar or differing properties are included within this invention. In certain aspects, a compound of formula I is combined with one or more additional 15 compounds that antagonize the function of a different channel. For example, a compound of formula I may be combined with one or more additional compounds that that antagonize TRPV 1, TPRM8, and/or TRPV3. The additional compounds that antagonize TRPV1 or TRPV3 may cross react with other TRP channels. When the compounds of formula I are combined with other TRP agents and/or additional 20 active agents such as antibacterials (e.g., penicillins, cephalosporins), antivirals, and the like, the combination includes simultaneous, sequential and separate administration of the active compounds in a way that the therapeutic effects of the first administered compound is still detectable when the subsequent therapy is administered. TRPAl antagonists of the subject invention can be used as part of a prophylaxis or 25 treatment for a variety of disorders and conditions, including, but not limited to, acute and chronic pain, touch sensitivity, bums, inflammation, fibromyalgia, diabetic neuropathy, pain associated with a dermatological disease or disorder, e.g., psoriasis and basal cell and squamous cell cariconomas,, eczema, dermatitis, post-herpetic neuralgia (shingles), migraine, incontinence, fever, hot flashes, osteoarthritis, oral mucositis, a neurodegenerative disease or 30 disorder, e.g., Alzheimer's disease (AD), Parkinson's disease, Huntington's disease, amyotrophic lateral sclerosis (ALS), and other brain disorders caused by trauma or other insults including aging, an inflammatory disease (e.g., asthma, chronic obstructive pulmonary disease, rheumatoid arthritis, osteoarthritis, inflammatory bowel disease, glomerulonephritis, neuroinflammatory diseases, multiple sclerosis, and disorders of the immune system), cancer 35 pain (e.g. liposarcoma) or other proliferative disease, kidney disease and liver disease, a -40 - WO 2011/043954 PCT/US2010/050493 metabolic disorder such as diabetes; bladder cystits, oral pain (e.g. canker sores, aphthous ulcers, gingivostomatitis, etc.), pancreatic pain, pain associated with Crohn's disease and Irritable Bowel Syndrome (IRS), rheumatoid arthritis, Grierson-Gopalan syndrome (better known as burning feet syndrome), burning mouth syndrome (BMS), Complex Regional Pain 5 Syndrome(CRPS; also known as chronic regional pain syndrome), and cough, or is used as a depilatory to promote loss of or inhibit the growth of hair on a patient. Further diseases and conditions include post-surgical pain, post herpetic neuraligia, incontinence; and shingles. Blockers of voltage-gated calcium channels belong to a class of medications originally developed to treat hypertension. Such blockers inhibit the movement of calcium into the muscle 10 cells of the heart and arteries. Because-calcium is needed for these muscles to contract, such blockers lower blood pressure-by decreasing the force of cardiac contractile response and relaxing the muscle walls of the arteries. Although TRPAI is not a voltage-gated calcium channel, it is still instrumental in regulating calcium homeostasis, as well as the balance of other ions, in cells and tissues. Accordingly, TRPA I antagonists of the invention may be used to treat 15 hypertension. Additional uses of the subject compounds include other conditions that may be ameliorated, in whole or in part, by relaxing the muscle walls of blood vessels. Exemplary conditions include headaches and migraine attacks. Other exemplary diseases or conditions that can be treated using a TRPA I antagonist of the present invention are detailed throughout the specification. Thus, the present invention relates 20 to the use of the compounds of formula I in the treatment of or to reduce the symptoms of any of the diseases or conditions disclosed in the application. The invention further contemplates the use of the compounds of formula I in the manufacture of a medicament or pharmaceutical preparation to treat or reduce the symptoms of any of the diseases or conditions provided herein. Compounds for use in treating a particular disease or condition can be formulated for 25 administration via a route appropriate for the particular disease or condition. TRPA I antagonists can -be administered alone or in combination with other therapeutic agents. For instance, the TRPAI antagonists of the claimed invention can be combined with one or more of an anti-inflammatory agent, anti-acne agent, anti-wrinkle agent, anti-scarring agent, anti-psoriatic agent, anti-proliferative agent, anti-fungal agent, anti-viral agent, anti-septic agent, 30 anti-migraine agent, keratolytic agent, or a hair growth inhibitor. Another aspect of the present invention relates to a method for treating or preventing a condition involving activation of TRPAI or for which reduced TRPA1 activity can reduce the severity by administering a TRPAl antagonist that inhibits TRPAl-mediated current and/or TRPA I-mediated ion flux. -41- WO 2011/043954 PCT/US2010/050493 Another aspect of the present invention relates to a TRPA 1 inhibitor that is used to treat or ameliorate pain. Exemplary classes of pain that can be treated using a TRPA1 inhibitor include, but are not limited to nociceptive pain, inflammatory pain, and neuropathic pain. Pain that can be treated with a TRPAl inhibitor can be chronic or acute. Thus, in another aspect of 5 the invention the TRPAl antagonist of formula I is administered to prevent, treat or alleviate signs and symptoms of acute pain, chronic pain, touch sensitivity, itching sensitivity, or as part of treating a burn, such as, for example, post-surgical pain, cancer pain, or neuropathic pain. Still in another aspect of the invention a compound of formula I is administered to prevent, treat or alleviate signs and symptoms of migraine. 10 In another aspect of the invention a compound of formula I is administered to prevent, treat or alleviate signs and symptoms of a disorder-or condition selected from the group consisting of diabetic neuropathy, inflammation, psoriasis, eczema, dermatitis, post-herpetic neuralgia (shingles), incontinence, bladder incontinence, fever, hot flashes, pancreatitis, chronic regional pain syndrome, Fabray's disease, and cough. In another aspect of the invention a compound of 15 formula I is administered to prevent, treat or alleviate signs and symptoms of osteoarthritis. In another aspect of the invention a compound of formula I is administered to prevent, treat or alleviate signs and symptoms of rheumatoid arthritis. In another aspect of the invention a compound of formula I is administered to prevent, treat or alleviate signs and symptoms of oral mucositis. In another aspect of the invention a compound of formula I is administered to 20 promote loss of or inhibit the growth of hair on a patient. In another aspect of the invention a compound of formula I is used to treat or ameliorate the symptoms of incontinence. Because of the important role that calcium regulation plays in many cellular processes including cellular activation, gene expression, cellular trafficking and apoptotic cell death, calcium dyshomeostasis is implicated in the many diseases and disorders involving such cellular 25 activities. These diseases and disorders include dermatological diseases and disorders; neurological and neurodegenerative diseases and disorders; fever associated with various diseases, disorders or conditions; incontinence; inflammatory diseases and disorders such as inflammatory bowel disease and Crohn's disease; respiratory diseases and disorders such as chronic cough, asthma and chronic obstructive pulmonary disease (COPD); digestive disorders 30 such as ulcers and acid reflux; metabolic diseases and disorders including obesity and diabetes; liver and kidney diseases and disorders; malignancies including cancers; aging-related disorders; and sensitivity to pain and touch. Additional diseases or conditions that can be treated include ATP-related diseases or disorders including epilepsy, cognition, emesis, pain (e.g., migraine), asthma, peripheral vascular 35 disease, hypertension, immune and inflanunatory conditions, irritable bowel syndrome, cystitis, - 42 - WO 2011/043954 PCT/US2010/050493 depression, aging-associated degenerative diseases, urinary incontinence, premature ejaculation, cystic fibrosis, diabetes, contraception and sterility, and wound healing (see, for example, Foresta et al. (1992) J. Biol. Chem. 257:19443-19447; Wang et al. (1990) Bioehirn. Biophys. Res. Common. 166:251-258; Burnstock and Williams, (2000) J. Pharmacol. Exp. Ther. 295: 862-869; 5 and Burnstock, Pharmacol Rev (2006) 58:58-86). In still another aspect of the invention the TRPA 1 inhibitor is non-narcotic and has little or no narcotic side-effects. Thus, the TRPAI inhibitor can be used to treat or ameliorate pain with fewer side-effects than narcotic pain relievers. Exemplary side-effects that may be substantially absent at effective dosages of TRPV3 inhibitors include one or more of 10 exopthalmos, catalepsy, disruption of gut motility, and inhibition of sensation in non-injured areas of the body. In other aspects of the invention, a TRPA1 inhibitor used in the treatment of any of the diseases or indications disclosed herein has one or more of the structural or functional characteristics disclosed herein. TRPA1 inhibitors described herein can be used in the treatment 15 of any of the foregoing or following diseases or conditions, including in the treatment of pain associated with any of the foregoing or following diseases or conditions. When used in a method of treatment, an inhibitor can be selected and formulated based on the intended route of administration. Inhibitors can be used to treat the underlying disease or condition, or to relieve a symptom of the disease or condition. Exemplary symptoms include pain associated with a 20 disease or condition. The present invention provides methods for treating pain that include administration of (i) antagonists of a TRPA1 function; (ii) combinations of selective antagonists of a TRPA1 function and selective antagonists offRPV1 and/or TRPV3 function; or (iii) a pan-TRP inhibitor that inhibits a function of two or more of TRPAI, TRPV1, and TRPV3. 25 In addition to TRPV family members, other TRP channels have been implicated in pain reception and/or sensation. For example, certain TRPM channels including TRPMB have been implicated in the reception and/or sensation of pain. Accordingly, in certain embodiments, the methods of the present invention include treating pain by administering (i) a combination of a selective TRPAI antagonist and a selective TRPMB antagonist; (ii) a combination of a selective 30 TRPA1 antagonist, a selective TRPMB antagonist, and one or more of a selective TRPV I. and/or TRPV3 antagonist; (iii) a cross-TRP inhibitor that antagonizes a function of TRPA I and TRPM8; or (iv) a pan inhibitor that antagonizes a function of TRPA1, TRPM8, and one or more of TRPVI and TRPV3. - 43 - WO 2011/043954 PCT/US2010/050493 In another aspect of the present invention there is provided the use of a TRPA1 inhibitor in the manufacture of a medicament for treating or preventing a condition involving activation of TRPA1 or for which reduced TRPAI activity can reduce the severity, wherein the TRPAI inhibitor is represented by the compound of formula 1, or a pharmaceutically acceptable salt 5 thereof, or a solvate, hydrate, oxidative metabolite or prodrug of the compound or its salt). In some aspects of the invention, the compounds can be used to inhibit a TRPA1 mediated current and/or TRPAI-mediated ion flux in vitro, for example in cells in culture. In some embodiments, the compounds can be used to inhibit a TRPAI mediated current in vivo. In certain embodiments, the compounds inhibit both an inward -and an outward TRPA 1 10 mediated current. In certain embodiments, the compounds inhibit a TRPAl mediated ion flux in vitro, for example in cells in culture. In certain other embodiments, the compounds inhibit a TRPA1 mediated influx in vivo. The invention contemplates pharmaceutical compositions and uses of TRPA antagonists having any combination of the foregoing or following characteristics, as well as any 15 combination of the structural or functional characteristics of the TRPA1 antagonists described herein. Any such antagonists or preparations can be used in the treatment of any of the diseases or conditions described herein. Any such antagonists or preparations can be used to inhibit a function of TRPA1, for example a TRPA1-mediated current and/or a TRPAI -mediated ion flux. Abbreviations used in the description of the chemistry and in the Examples that 20 follow are: CH2Cl2 dichloromethane Boc tert-butoxycarbonyl DIEA diisopropylethylamine PMB 4-methoxy-benzyl 25 PMBBr 4-methoxy-benzyl bromide THF tetrahydrofuran TFA trifluoroacteic acid MeOH methanol PS-PPh3 polystyrene triphenyphosphine 30 DMF NN-dimethylformamide DMA N,N-dimethylacetamide EtOAc ethyl acetate - 44- WO 2011/043954 PCT/US2010/050493 RT/ml room tempature AD Alzheimer's Disease NMR Nuclear Magnetic Resonance DMSO dimethyl sulfoxide 5 Several methods for preparing the compounds of this invention are illustrated in the following Schemes and Examples. Starting materials and the requisite intermediates are in some cases commercially available, or can be prepared according to literature procedures or as illustrated herein. 10 The compounds of this invention are prepared by employing reactions as shown in the schemes and examples herein, in addition to other standard manipulations such as ester hydrolysis, cleavage of protecting groups, etc., as may be known in the literature or exemplified in the experimental procedures. The compounds of this invention may be purified by the standard purification methods such as normal phase chromatography, HPLC, Chiral HPLC, SFC and other 15 methods that are known in the literature or exemplified in the experimental procedures. Substituent numbering as shown in the schemes does not necessarily correlate to that used in the claims and often, for clarity, a single substituent is shown attached to the compound where multiple substituents are allowed under the definitions hereinabove. Reactions used to generate the compounds of this invention are prepared by employing reactions as shown in the schemes 20 and examples herein, in addition to other standard manipulations such as ester hydrolysis, cleavage of protecting groups, etc., as may be known in the literature or exemplified in the experimental procedures. In some cases the final product may be further modified, for example, by manipulation of substituents. These manipulations may include, but are not limited to, reduction, 25 oxidation, alkylation, acylation, and hydrolysis reactions which are commonly known to those skilled in the art. In some cases the order of carrying out the foregoing reaction schemes may be varied to facilitate the reaction or to avoid unwanted reaction products. The following examples are provided so that the invention might be more fully understood. These examples are illustrative only and should not be construed as limiting the invention in any way. 30 Synopsis of Reaction Schemes -45- WO 2011/043954 PCT/US2010/050493 General Reaction Scheme I Scheme I H H TMSCI, Et 3 N mCPA + DMF130 0 OC CH 2 01 2 HOO O OTMS 0 O 1-1 1-2 1-3 1-4 H 2 N NaBH(OAc) 3 AcOH, DCE H HO HN 5 1-5 Reaction Scheme I illustrates the preparation of the compounds of the instant invention, starting with a commercially available decalone I-1. This material can be converted to the corresponding TMS enolether 1-2. Intermediatel-2 reacts with mCPBA followed by aqueous work up to produce ketone alcohols 1-3 and 1-4. 1-3 and 1-4 can then undergo reductive 10 amination, in parallel, with a diverse array of amines to provide 1-5 and 1-6. General Reaction Scheme II - 46 - WO 2011/043954 PCT/US2010/050493 (COCl) 2 , DMSO O Li N CNN CNN N Et 3 N, CH 2 CI 2 N C THF NlCN 'OH 0 HO HO 11-1 1-2 11-3 1. AgNO 3 , EtOH 2. TsOH, H 2 O/THF H N ra H 2 NN NH 4 Ac, N H2N -R Pd/C, EtOH N HOHN HO NaBH(OAc) 3 -R -R AcOH in CHC 2 11-6 11-5 11-4 0 NaBH(OAc)s R ',H IAcOH in CHC1 2 R CN HOH HN -R 11-7 Reaction Scheme II depicts the synthesis of the compounds of the instant invention, starting with aminoalcohol 11-1 which is prepared according to literature (Jacobsen, E.; Levin, J.; Overman, L. J Am. Chem. Soc. 1988, 110, 4329). 11-1 was subjected to Swern 5 oxidation condition to give ketone 11-2 which was treated with lithiated ethylvinylether in THF to afford tertial alcohol 11-3. Treatment of AgNO 3 in Ethanol followed by acidic hydrolysis produces oxocyclohexapiperidine product 11-4. Reductive amination with various anilines affords aminopiperidine 11-5 which, upon hydrogenation, affords piperidine 11-6. 11-6 can then undergo reductive amination, in parallel, with a diverse array of amines to provide 11-7. 10 General Reaction Scheme III -47 - WO 2011/043954 PCT/US2010/050493 o 0 o ' 0 C 111-1 111-2 11-3 111-4 z x 111-5 RCOM z 111-6 I mCPBA H H z +z x:T x - O O 0 0 111-7 111-8 H 2 N AIMe 3 -R I H H w 1 z w z HO HO HN -R HN N 111-9 111-10 Reaction Scheme III depicts the synthesis of compounds of the instant invention, starting with cyclohexanone (III-1 and 111-2) or pyranone (111-3 and 111-4), all of which requires 5 multiple step synthesis from commercially available starting material (their synthesis are detailed in the example section). Olefination via Wittig reaction provides dialkene III-5 (W, X, Y, Z - 48 - WO 2011/043954 PCT/US2010/050493 represents oxygen in each individual substrate) which undergoes a standard ring-closure-olefine metathesis to provide 111-6. 111-6 is then treated with mCPBA to give epoxides 111-7 and 111-8. III 6 and 111-7 can then undergo epoxide opening reaction, in parallel, with a diverse array of amines in the presence of AlMe 3 to provide III-8 and 111-9 respectively. 5 General Reaction Scheme IV H H mCPBA 0 0H rv-1 IV-2 H 2 N IV-3 AIMe 3 R H H HO HO HN N HN N 1 7 -R R IV-4 IV-5 10 Reaction Scheme IV depicts the synthesis of the compounds of the instant invention, starting with hexahydrochromene IV-I which is prepared according to literature (Yeh, P. M.; Lee, Y-C; Young, T-C. Synthesis 2006, 21, 3621). IV-l is treated with mCPBA to give epoxides IV-2 and IV-3. IV-2 and IV-3 can then undergo epoxide opening reaction, in parallel, with a diverse array of amines in the presence of AlMe 3 to provide IV-4 and IV-5 respectively. 15 General Reaction Scheme V - 49 - WO 2011/043954 PCT/US2010/050493 / Br N+ o 0 ~00 LHMDS V-1 V-2 V-3 1. NaBH4 2. TBDPSCI, imidazole OTBDPS 0 H H2N OTBDPS OTBDPS lR0 H mCPBA H H AIMe --RO HNr) N la6 V-6 V-5 V-4 TBAF OH OR 0 H O H 0o HO HO HN -R HN N I -R R V-7 V-S Reaction Scheme V illustrates the preparation of the compounds of the instant invention, starting with a commercially available pyran-5-carbaldehyde V-1. This material can be 5 converted to the corresponding olefin V-2 via a Wittig reaction. Diels-alder reaction between V 2 and acrolein provides aldehyde V-3 which was reduced by sodium borohydride and the ensuing alcohol is protected as its tert-butyldiphenylsilyl ether V-4. V-4 is treated with mCPBA to give epoxides V-5 which then undergo epoxide opening reaction, in parallel, with a diverse array of amines in the presence of AlMe 3 to provide V-6. TBAF treatment to remove the silyl protecting 10 group provides alcohol V-7 which is then converted via alkylation, in parallel, with a diverse array of alkylating reagents to provide V-8. - 50 - WO 2011/043954 PCT/US2010/050493 Examples Examples provided are intended to assist in a further understanding of the invention. Particular materials employed, species and conditions are intended to be further 5 illustrative of the invention and not limitative of the reasonable scope thereof The reagents utilized in synthesizing the compounds depicted in the following Tables are either commercially or are readily prepared by one of ordinary skill in the art. EXAMPLE 1 10 (4R,4aR,8aR)-4-(phenylamino)octahydronaphthalen-4a(211)-ol Scheme I H H TMSCI, Et 3 N mCPBA + DMF, 1300 TN0 CH 2 01 2 HOO O OTMS 0 0 1-1 1-2 1-3 1-4 H2N NaBH(OAc)3 H HO HN N 1-5 Trimethyl(2,3,4,4a,5,6,7,8-octahydronaphthalen- 1 -yloxy)silane (1-2) 15 To Decalone (2500 mg, 16.42 mmol) and triethylamine (5.49 ml, 39.4 mmol) in DMF (6.569 ml) at room temperature was added TMS-Cl (2.52 ml, 19.71 mmol) and the reaction mixture was heated to 130 'C and stirred for 3 days. The mixture was cooled, diluted with ether (50 mL) and washed with aqueous sodium hydrogen carbonate. The aqueous layer was extracted with diethyl ether. The combined organic fractions were washed with brine, dried, filtered and the solvent 20 was evaporated under reduced pressure. The residue was purified by column chromatography on silica gel to give the title compound as a colorless liquid. -51 - WO 2011/043954 PCT/US2010/050493 (4aR,8aR)-8a-hydroxyoctahydronaphthalen- 1(2H)-one (1-3) and (4aR,8aS)-8a hydroxyoctahydronaphthalen- 1(211)-one (1-4) 5 To trimethyl(2,3,4,4a,5,6,7,8-octahydronaphthalen-1-yloxy)silane (1310 mg, 5.84 mmol) in dichloromethane (18.700 ml) was added mCPBA (1209 mg, 7.00 mmol) portion-wise at 0 oC. The reaction mixture was then allowed to warm up to RT and stirred for 1 hr. The mixture was cooled and quenched with saturated aqueous Na 2 SQ 3 . The mixture was then diluted with CH 2 Cl 2 (50 mL) and washed with aqueous sodium hydrogen carbonate (saturated, 20 mL). The aqueous 10 layer was extracted with dichloromethane (3 x 30 mL). The combined organic fractions were washed with brine (saturated, 20 mL), dried, filtered and the solvent was evaporated under reduced pressure. The residue was purified by column chromatography on silica gel to give the title compound 1-3 and the title compound 1-4 as colorless liquids. 'H-NMR (500 MHz, CDCl 3 ) 1-3: 8 3.02 (in, lH), 2.22 (m, 1 H), 2.03 (m, IH), 1.38-1.80 (in, 12 H), 1.22 (m, IH); 1-4: 6 3.76 15 (bs, 1H), 2.58 (m, 1H), 2.45 (m, I H), 2.10 (m, iH), 1.90-2.02 (m, 3 H), 1.45-1.85 (in, 8 H), 1.30 (m, IH); (4R,4aR,8aR)-4-(phenylamino)octahydronaphthalen-4a(2H)-o (1-5) 20 A mixture of (4aR,8aR)-8a-hydroxyoctahydronaphthalen-1(2H)-one (0.339 g, 2.015 mmol) and aniline (0.552 mL, 6.05 mmol) in 2% CH 3 COOH in DCE (20 mL) was stirred for 1 hr at rt. Sodium triacetoxyborohydride (1.37 g, 6.45 mmol) was then added and the mixture was stirred for several hours. The mixture was then quenched with sat'd. aq. NaHCO 3 and extracted 3x with CH 2 Cl 2 . The combined organics were dried, filtered, and concentrated. The residue was 25 purified by colunm chromatography on silica gel to give the title compound. 1 H NMR (500 MHz, CDCl 3 ) 5 7.12-7.18 (m, 2H), 6.60-6.69 (m, 314), 1.96-2.04 (in, IH), 1.73-1.81 (in, 1H), 1.64-1.70 (m, 2H), 1.18-1.60 (m, 12H). HRMS (ES) m/z M+fH calc'd:246.1852, found: 246.1850. 30 TABLE 1 # Structure MS M + 1 - 52 - WO 2011/043954 PCT/US2O1O/050493 1-6 F 264.1747 HO~ HN 1-7 F 282.1665 HOH F 1-8 322.2162 Na HOH 1-9 -~297.1958 HOH :N 1-10 'N274.2165 HO HNY 1-11 HNa CN 271.2 HOHY' -53 - WO 2011/043954 PCT/US2010/050493 1-12 HN 271.2 HOHN EXAMPLE 2 (4R,4aS,8aR)-1 -ethyl-4-(phenylamino)octahydroquinolin-4a(2H)-o 5 Exmke scheme 2 A ' (C O C I) 2 , D M S O N A'O A L L i N CN Et3N, CH2CI2 K NCN THF N CN OH 0 HO 2-1 2-2 2-3 N Na NH 4 AC, N 1 HA OPd/C, EtH, 60*C N[H 2 0/THF N HN N2. NaBH 4 HN EtOH, DOCE AH2 2-6 2-5- 2-4 0 q. NaHCO 3 CI CH2C12 0 N H 2-7 {Benzyl[(lR)-2-oxocyclohexyl]amino}acetonitrile (2-2) To oxalyl chloride (1.842 ml, 3.68 mmol) in CH2C12 (12.300 ml) at -78 'C was added DMSO 10 (0.523 ml, 7.37 mmol). The reaction mixture was stirred for 10 min and then {benzyl[(lR,2R)-2 hydroxycyclohexyl]amino}acetonitrile (2-1) (300 mg, 1.228 mmol) in 2 ml of CH2Cl2 was - 54 - WO 2011/043954 PCT/US2010/050493 added. The reaction mixture was stirred at -78 'C for 1 hr before triethylamine (2.054 ml, 14.73 mmol) was added. The reaction mixture was stirred at -78 'C for 30 min and then warm gradually to 0 'C. After another 30 min the reaction was quenched by H20. The reaction mixture was diluted with aqueous potassium carbonate (saturated, 20 mL) and extracted with 5 dichloromethane (3 X 30 mL). The combined organic fractions were washed with brine (saturated, 30 mL), dried, filtered. The organic phase was concentrated and the residue was diluted with dry THF, filtered with 0.25 uM filter and concentrated to give the title compound. LRMS m/z (M+H) Caled:243.1, found: 243.3. 10 {Benzyl [(I R,2R)-2-(1 -ethoxyethenyl)-2-hydroxycyclohexyl] amino} acetonitrile (2-3) To {benzyl[(IR)-2-oxocyclohexyl]amino}acetonitrile (298 mg, 1.230 mmol) in THF (9 ml) at 78 'C was added ethylvinyl ether lithium (7.38 ml, 3.69 mmol) in THF via a cannula dropwise over 25 min. The reaction mixture was stirred for an addition 40 min at -78 *C before wet THF 15 (THF/Water 10/1, 10 ml) was added. The reaction was allowed to warm to room temperature. The mixture was cooled, aqueous potassium carbonate (saturated, 10 mL) was added and the mixture was extracted with ethyl acetate (3 x 20 mL). The combined organic fractions were washed with brine (saturated, 30 mL), dried, filtered and the solvent was evaporated under reduced pressure to give the title compound. The crude product was used directly without further 20 purification in the next step. (4aR,8aR)-1-benzyl-4,4-diethoxyoctahydroquinolin-4a(2H)-ol (2-4) To silver nitrate (125 mg, 0.735 mmol) in Ethanol (27.00 ml) at room temperature was added 25 {Benzyl[(1R,2R)-2-(I-ethoxyethenyl)-2-hydroxycyclohexyl]amino}acetonitrile (220 mg, 0.700 mmol) in 10 ml of absolute ethanol. The reaction mixture was stirred for an addition 1 hr. Another 125 mg of Silver Nitrate was added and the reaction was stirred overnight. The reaction mixture was filtered through a pad of celite, concentrated. The residue was purified by column chromatography (dry load) on silica gel, eluting with CH 2 C2/MeOH/NH3(Aq.) to give the title 30 compound.. 'H-NMR (500 MHz, CDCl 3 ) 2-4: 6 7.20-7.36 (in, 5H), 4.07 (d, 1 H), 3.74 (dt, 1 H), 3.62 (dt, 1 H), 3.52 (dt, 1 H), 3.41 (dt, 1 H), 3.28 (bs, 1 H), 3.06 (d, 1 H), 2.61 (in, IH), 2.00 2.14 (m, 2 H), 1.88-1.98 (in, 2 H), 1.70-1.80 (m, 2 H), 1.54-1.62 (in, 2 H), 1.22-1.44 (m, 2H), 1.18 (t, 6 H). LRMS m/z (M+H) Calcd:334.5, found: 334.5. - 55 - WO 2011/043954 PCT/US2010/050493 (4R,4aS,8aR)- 1 -benzyl-4-(phenylamino)octahydroquinolin-4a(2H)-ol (2-5) To (4aR,8aR)-1-benzyl-4,4-diethoxyoctahydroquinolin-4a(2H)-ol (200 mg, 0.600 mmol) in toluene (12.000 ml) at room temperature was added water (0.162 ml, 9.00 mmol) followed by 5 camphorsulfonic acid (153 mg, 0.660 mmol). The reaction mixture was heated to reflux for 3 hrs. The reaction mixture was diluteded with aqueous potassium carbonate (saturated, 30 mL). The aqueous layer was extracted with ethyl acetate (3 x 20 mL). The combined organic fractions were washed with brine (saturated, 30 mL), dried, filtered and the solvent was evaporated under reduced pressure. A mixture of (4aR,8 aS)- I -benzyl-4a-hydroxyoctahydroquinolin-4(l 1)-one 10 (0.500 g, 1.93 mmol) and aniline (0,528 mL, 5.78 mmol) in 4% CH 3 COOH in DCE (10 mL) was stirred for 4 hr at 80*C. The reaction was then cooled to rt and NaBH 4 (0.438 g, 1 l.6-mmol) was then added followed by the addition of EtOH (10 mL). The mixture was then stirred overnight at rt. The mixture was then quenched with sat'd. aq. NH 4 Cl. It was then basified with 2M Na 2 CO 3 and extracted 3x with EtOAc. The combined organics were dried, filtered and concentrated. The 15 residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDCl 3 ) 6 7.29-7.35 (m, 4H), 7.23-7.30 (mo, IH), 7.17 (t, 2H, J = 8.3 Hz), 6.76-6.84 (to, 3H), 4.10 (d, 1H, J= 8.0 Hz), 3.96 (d, 1H, J = 13.2 Hz), 3.03 (d, 1H, J = 13.2 Hz), 2.97 (s, 1H), 2.86 (t, lH, J = 7.8 Hz), 2.37 (d, 1H, J = 6.8 Hz), 1.41-2.24 (in, 10 H). HRMS (ES) m/z M+H calc'd: 337.2274, found: 337.2275. 20 (4aR,8aS)-4-(phenylamino)octahydroquinolin-4a(2H)-o (2-6) To a mixture of (4aS,8aS)- 1 -benzyl-4-(phenylamino)octahydroquinolin-4a(2H)-ol (0.280 g, 0.832 mol) in MeOH (5 mL) was added NH 4 COOH (0.840 g, 13.3 mmol) and 10 % Pd/C (0.280 g). The resulting mixture was heated at 604C for several hours. The reaction was 25 cooled to rt, filtered through a syringe filter, washed with EtOH, and concentrated to give the title compound. LRMS M+H calc'd: 247.34, found 247.34 1-[(4aS,8aS)-4a-hydroxy-4-(phenylamino)octahydroquinolin-1 (2H)-yl]-3-methylbutan-1-one (2 7) 30 To a mixture of (4aR,8aS)-4-(phenylamino)octahydroquinolin-4a(2H)-ol (20 mg, 0.081 mmol) in 1:1 CH 2 Cl 2 :sat'd. aq. NaHCO 3 (3 mL) was added 3-methylbutanoyl chloride (0.049 g, 0.406 mmol). The mixture was stirred at rt for 1 hr. The mixture was diluted with sat'd. aq. NaHCO 3 and CH 2 C1 2 and extracted 3x with CH 2 CI 2 . The combined organics were dried (anhd. Na 2 SO 4 ), filtered, and concentrated. The residue was purified by column - 56 - WO 2011/043954 PCT/US2010/050493 chromatography to give the title compound. 'H NMR (400 MHz, CDC1 3 ) 8 7.22-7.40 (m, 5H), 4.38 (d, IH, J = 10.4 Hz), 3.96 (d, 1H, J = 10.2 Hz), 3.35 (t, IH, J = 9.4 Hz), 2.62-2.85 (m, 2H), 1.15-2.40 (in, 12 H), 0.81-0.99 (m, 6H). HRMS (ES) m/z M+H calc'd:331.2380, found: 331.2379. 5 TABLE2 # Structure MS M + 1 2-8 289.1911 HN HO 2-10 H H 337.2233 N HO 0 N H 2-11 351.2065 HO HN N H - 57 - WO 2011/043954 PCT/US2010/050493 2-12 391.2378 HOHN H_ EXAMPLE 3 (4R,4aS,8aS)-4-[(4-fluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-o Example Scheme 3 O HPCC, CH 2 C1 2 FeCl3 OH 0 3-1 3-2 Br 3-3 P+ NaHMDS, THF H O 0 mCPBA o Zhan-1b, + CH2C'2 CH 2 C CC 0 O 3-6 3-5 3-4 H 2 N F F H AIMe 3 , CH 2 C 2 HO HN 3-7 5 2-(but-3-en-1-yloxy)cyclohexanol (3-2) To a mixture of cyclohexene oxide (3-1) (10.0 g, 102 mmol) in 3-buten-1-ol (17.4 mL, 204 mmol) cooled to 0 0 C was added FeCl 3 (1.65 g, 10.2 mol) The mixture was removed from the ice bath and stirred at rt for I hr. The reaction was quenched with water and extracted ether. The - 58 - WO 2011/043954 PCT/US2010/050493 combined organics were washed with brine, dried, filtered, and concentrated. The residue was purified by column chromatography to give the title compound. 1 H NMR (400 MHz, CDCI 3 ) 6 5.77-5.88 (in, 1H), 5.00-5.15 (m, 2H), 3.69-3.76 (m, 1H), 3.39-3.44 (m, 2H), 2.98-3.05 (in, I H), 2.74 (s, 1K), 2.30-2.39 (in, 2H), 1.94-2.11 (in, 3H), 1.61-1.79 (m, 3H), 1.06-1.37 (in, 2H). 5 2-(but-3-en-1-yloxy)cyclohexanone (3-3) To a suspension of PCC (26.6 g, 123 mmol) in CH 2 Cl 2 (160 mL) was added 2-(but-3-en-1 yloxy)cyclohexanol (7 g, 41 mmol) in CH2C12 (10 mL). The reaction was stirred at rt overnight. 10 The mixture was filtered through a pad of celite and washed with CHC2C12. The residue was purified by column chromatography to give the title compound. 1H NMR (500 MHz, CDCl 3 ) 6 5.75-5.90 (in, 1H), 4.95-5.15 (in, 2H), 3.78 (dd, 1H, J= 5.37 Hz, 9.76 Hz), 3.65-3.70 (in, 1K), 3.39-3.45 (in, 1H), 1.05-2.58 (in, 10 H). 15 1-(But-3-en-1-yloxy)-2-methylidenecyclohexane (3-4) To a mixture of methyltriphenylphosphonium bromide (22.30 g, 62.4 mmol) in THF (125 mL) at rt was added sodium hexamethyldisilylazide (2M in THF, 31.2 mL, 62.4 mmol) dropwise. The 20 mixture was heated to 600C for 1 hr. 2-(but-3-en-1-yloxy)cyclohexanone (7.0 g, 41.6 mnnol) was then added and the mixture was stirred at 60'C for 3 hr. The reaction was cooled to rt, quenched with sat'd, aq.NH 4 Cl, and extracted with Et20. The combined organics were dried filtered, and concentrated. The residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDCl 3 ) 8 5.78-5.90 (in, 1H), 5.00-5.13 (in, 2H), 4.82 (s, 1H), 4.78 (s, 1H), 25 3.74 (dd, 1H, J= 3.9 Hz, 6.3 Hz), 3.35-3.49 (in, 2H), 1.12-2.38 (in, 10 H). 3,5,6,7,8,8a-hexahydro-2H-chromene (3-5) A mixture of 1-(but-3-en-1-yloxy)-2-methylidenecyclohexane (5.21 g, 31.3 inmol) in DCE (313 30 mL) was degassed 3x N2/pump. Zhan-lb (1.15 g, 1.57 inmol mmol) was then added and the reaction was degassed again. The reaction was stirred at rt for 2 hr. The reaction mixture was concentrated and the residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDCl 3 ) 6 5.48 (d, 1H, J = 2.7 Hz), 3.90-3.96 (in, 2H), 3.50-3.60 (m, 1H), -59- WO 2011/043954 PCT/US2010/050493 2.18-2.34 (m, 2 H), 2.02-2.08 (m, IH), 1.84-1.99 (in, 2H), 1.76-1.83 (in, 1H), 1.66-1.74 (m, IH), 1.15-1.43 (in, 3H). (1aS,8aS)-hexahydro-1aI,4aH-oxireno[djchromene (3-6) 5 To a mixture of 3,5,6,7,8,8a-hexahydro-2H-chromene (3.27 g, 23.66 mmol) in CH 2 CI 2 (75 mL) at 0 0 C was added MCPBA (~77%, 6.53 g, 28.4 mmol). The mixture was warmed to rt and stirred for 1 hr. The mixture was quenched with satd. aq. Na 2 SO 3 . The mixture was then partitioned between CH2C1 2 and sat'd. aq. NaHCO 3 . Extracted with CH 2 CI 2 . The combined 10 organics were dried, filtered, and concentrated. The residue was purified by column chromatography to give the title compound. 1 H NMR (500 MHz, CDC 3 ) 3 3.85 (dd, 1H, J= 7.8 Hz, 11.7 Hz), 3.54 (dd, lH, J = 4.6 Hz, 11.7 Hz), 3.31-3.38 (in, IH), 3.19 (d, lH, J = 5.13 Hz), 2.15-2.24 (in, 1H), 1.75-1.97 (m, 4H), 1.52-1.72 (in, 3H), 1.37-1.49 (in, 1H), 1.30-1.38 (in, 1H). 15 (4R,4aS,8aS)-4-[(4-fluorophenyl)anino]hexahydro-2H-chromen-4a(5H)-ol (3-7) To a mixture of 4-Fluoroaniline (0.173 g, 1.56 mmol) in CH 2 Cl 2 (3 mL) at 0 0 C was added trimethylaluminum (2M in touene, 0.778 mL) dropwise. The mixture was warmed to rt and stirred for 30 min. Trans hexahydro-laHI,4aH-oxireno[d]chromene (0.200 g, 1.30 mmol) in 20 CH2C12 (2 mL) was then added and the mixture was stirred at rt overnight. The reaction was cooled to 0 0 C and treated with 50% NaOH (1 mL) then water (1 mL). The reaction mixture was extracted 3x with CH 2 CI 2 . The combined organics were dried, filtered, and concentrated. The residue was purified by column chromatography to give the title compound. 1 H NMR (500 MHz, CDCl 3 ) 3 6.90 (t, 2H, J = 8.8 Hz), 6.60 (dd, 2 H, J = 4.2 Hz, 8.8 Hz), 3.88 (dd, 1H, J = 5.4 Hz, 25 12.0 Hz), 3.68-3.74 (m, 1H), 3.47 (dd, 1H, J = 4.8 Hz, 11.5 Hz), 3.40 (t, IH, J = 3.2 Hz), 2.30 2.40 (in, IH), 1.69-1.78 (m, 2H), 1.54-1.68 (m, 5H), 1.45-1.48 (m, 1H), 1.20-1.30 (m, 1 H), HRMS (ES) ni/z M+H calc'd.: 266.1551 found: 266.1556 TABLE 3 #t Structure MS M + 1 - 60 - WO 2011/043954 PCT/US2010/050493 3-8 H o 266.1556 HO HN F 3-9 H 266.1553 HO HN 3-10 H o 280.1711 HO0 N 3-11 H O 248.1653 HOHN HN, 3-12 H o 284.1467 H6 HN F ): F EXAMPLE 4 (4R,4aR,8aR)-4-[(4-fluorophenyl)amino]octahydro-4aH-isochromen-4a-ol 5 -61- WO 2011/043954 PCT/US2010/050493 Example scherne4 O 0 O HO OH O 0 LAH, THF OH O TsOH, toluene, 1200C O O 4-1 4-2 4-3 1. NaH, THF Br-B / / Br 1.2 HCI, H 2 0, THF 0 13 mCPBA NaHMDS, THF, 600C -O0 CH2C 2 0 2.MOM 6 6 Zhan-lb, CH 2 Cl 2 4-6 4-5 4-4 H 2 N F I F AlMe 3 , CH 2 CI2 H HO HNF 4-7 Methyl 1,4-dioxaspiro[4.5]decane-6-carboxylate (4-2) A mixture of methyl-2-oxocyclohexanecarboxylate (4-1) (7.0 g, 44.8 mmol), ethylene glycol 5 (3.00 mL, 53.8 mmol) andp-toluenesulfonic acid monohydrate (0.853 g, 4.48 mmol) in Benzene (45 mL) was heated to reflux overnight. The reaction was then cooled to rt and concentrated. The residue was purified by column chromatography to give the title compound. 1 H NMR (500 MHz, CDCl 3 ) 6 3.86-3.99 (in, 4H), 3.69 (s, 3H), 2.69 (dd, 1H, J = 4.9 Hz, 9.0 Hz), 1.82-1.97 (m, 3H), 1.58-1.73 (m, 3H), 1.45-1.53 (m, 1H), 1.26-1.37 (m, 1H). 10 1,4-dioxaspiro[4.5]dec-6-ylmethanol (4-3) - 62 - WO 2011/043954 PCT/US2010/050493 To a mixture of methyl 1,4-dioxaspiro[4.5]decane-6-carboxylate (3.00 g, 15.0 mmol) in THF (45 mL) at 0*C was added LiAIH 4 (2M in THF (9.00 mL, 18.0 mmol) dropwise. The mixture was then allowed to wann to rt and stirred overnight. The mixture was then cooled to 0 0 C and 1.36 mL of H20 was added very slowly. The reaction mixture was basified by adding 0.682 mL of 5 15% NaOH and then 3.41 mL of H20. The resulting mixture was filtered through a pad of celite, washed with Et 2 0, and concentrated. The residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDCl 3 ) 8 3,95-4.05 (in, 4H), 3.71-3.79 (m, 111), 3.52-3.59 (m, 11H), 2.81 (dd, 1H, J= 3.9 Hz, 7.1 Hz), 1.78-1.91 (in, 2H), 1.61-1.73 (in, 3H), 1.41-1.53 (m,.2H), 1.24-1.40 (in, 2H). 10 2-[(prop-2-en- 1-yloxy)methyl]cyclohexanone (4-4) To a mixture of NaH (1.14 g, 60% oil dispersion, 28.6 mmol) in dry THF (45 mL) at 00C was added 1,4-dioxaspiro[4.5]dec-6-ylmethanol (2.46 g, 14.3 mmol) in dry THF (5 mL). The mixture was allowed to warm to rt and stirred for 1 hr. The mixture was then cooled to 0 *C and 15 allyl bromide (2.10 mL, 24.28 mmol) was added in one portion. The mixture was then allowed to warm to rt and stirred for 1 hr. The mixture was then heated to 60'C overnight. It was cooled to 00C and quenched with 50 mL of 10 % aq HCL. This mixture was stirred for 1 hr at rt. The resulting mixture was cooled to 00C and neutralized carefully with solid Na 2 CO 3 and then extracted with Et 2 O. The combined organics were dried, filtered, and concentrated. The residue 20 was purified by column chromatography to give the title compound. '11 NMR (500 MHz, CDCl 3 ) 6 5.86-5.95 (m, IH), 5.28 (d, 1H, J= 1.7 Hz), 5.25 (d, 1H, J= 1.5 Hz), 5.17 (d, 1H, J= 10.5 Hz), 3.94-4.03 (in, 2H), 3.79 (dd, 1H, J 5.1 Hz, 9.8 Hz), 3.38 (dd, 1H, J = 7.33 Hz, 9.53 Hz), 2.56 2.65 (m, 111), 2.26-2.43 (in, 3H), 2.02-2.10 (in, 1H), 1.85-1.93 (in, 11), 1.61-1.74 (m, 2H), 1.39 1.49 (m, 111). 25 3,5,6,7,8,8a-hexahydro-IH-isochromene (4-5) To a mixture of methyltriphenylphosphonium bromide (3.75 g, 10.51 mmol) in THF (31 mL) at rt was added sodium hexamethyldisilylazide (2M in THF, 5.25 mL, 10.51 mmol) dropwise. The mixture was heated to 600C for 1 hr. 2-[(prop-2-en-1-yloxy)methyl]cyclohexanone (0.884 g, 5.25 minmol) in THF (4mL +2 mL rinse) was then added and the mixture was stirred at 60'C for 3 30 hr. The reaction was then cooled to rt, quenched with sat'd. aq. NH 4 Cl, and extracted with Et 2 O. - 63 - WO 2011/043954 PCT/US2010/050493 The combined organics were dried, filtered, concentrated, and purified via column chromatography. A mixture of (2-methylidenecyclohexyl)methyl prop-2-en-l-yl ether (0.104 g, 0.626 mmol) in DCE (6.5 mL) was degassed 3x N2/pump, then Zhan-Ib (0.023 g, 0.031 mmol) was added and 5 the reaction was degassed again The mixture was stirred at rt for 2 hr. It was concentrated and purified by silica gel chromatography to provide the title compound. 'H NMR (500 MHz, CDCL 3) 6 5.39 (t, 1H, J = 2.4 Hz), 4.04-4.10 (in, 2H), 3.92 (dd, 1H, J = 5.7 Hz, 11.2 Hz), 3.24 (dd, 1H, J= 8.2 Hz, 11.2 Hz), 2.15-2.27 (m, 2H), 1.92-2.02 (m, 1H), 1.74-1.83 (in, 2H), 1.64-1.72 (m, 1H), 1.18-1.45 (m, 2H), 0.93-1.06 (m, 1H). 10 Octahydrooxireno[d]isochromene (4-6) To a mixture of 3,5,6,7,8,8a-hexahydro-IH-isochromene (0.410 g, 2.97 mmol) in CH2Cl2 (10 mL) at 0 0 C was added MCPBA (-77%, 1.24 g, 445 mmol). The mixture was stirred at rt for 3 hr. It was quenched with satd aq. sodium sulfite. The mixture was diluted with CH 2 C1 2 and sat'd. aq. NaHCO 3 then extracted 3x with CH 2 Cl 2 . The combined organics were dried (anhd. Na 2 SO 4 ), 15 filtered, and concentrated. The residue was purified by column chromatography to give the title compound. (4R,4aR,8aR)-4-[(4-fluorophenyl)amino]octahydro-4aH-isochromen-4a-ol (4-7) 20 To a mixture of 4-fluoroaniline (0.721 g, 6.48 mmol) in CH2Cl2 (6 mL) at 0 0 C was added trimethylaluminum (2M in toluene, 3.24 mL) dropwise. The mixture was warmed to rt for 30 min. A mixture of both cis and trans octahydrooxireno[d]isochromene (0.200 g, 1.30 mmol) in CH2Cl2 2 mL +0.5 mL rinse) was then added and the mixture was stirred at rt overnight. The reaction was cooled to 0*C and treated with 50% NaOH (1 mL) then water (1 mL). The mixture 25 was diluted wtih more water and extracted 3x with CH 2 C2. The combined organics were dried (anhd. Na 2 SO 4 ), filtered, and concentrated. The residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDCl 3 ) 5 6.94 (t, 2H, J = 8.6 Hz), 6.78 (dd, 2H, J = 4.2 Hz, 8.8 Hz), 4.14 (dd, 1H, J 1.5 Hz, 12.0 Hz), 3.64 (d, 1H, J = 11.5 Hz), 3.56 (dd, 1H, J = 4.6 Hz, 11.0), 3.48 (t, 1H, J = 11.5 Hz), 3.10 (s, 1H), 1.17-2.00 (m, 9H). HRMS (ES) m/z 30 M+H cale'd.: 266.1551 found: 266.1554 - 64 - WO 2011/043954 PCT/US2010/050493 TABLE 4 # Structure MS M + 1 4-8 H o 266.1554 HO HN 4-9 H 280,1706 HO N F 4-10 H 248.1647 H 0 HN 4-11 H 284.1460 0 HO HN F F EXAMPLE 5 5 (4aS,8R,8aR)-8-[(4-fluorophenyl)amino]hexahydro-IH-isochromen-8a(3H)-ol - 65 - WO 2011/043954 PCT/US2010/050493 Example Scheme 5 / Br Q/ NH 2 NP+ nBuLi a o B ' 0 NaHMDS, THF 0 5-1 THF 5-2 5-3 Zhan-1 b, H H 2 N CH2C H H mCPBA o - F HN AIMe 3 , H 2 Cl 2 O CH2C 0N 0HI2 2 C1 2 1 5-4 5-6 F 5-5 4-(pent-4-en-1-yl)dihydro-2H-pyran-3(4H)-one (5-2) 5 Cyclohexylamine (3.43 ml, 30.0 mmol) was added to pyran-3-one (3000 mg, 30.0 mmol) in benzene (20 mL). The reaction mixture was stirred at RT for 30 min and then refluxed for 2 hr with a dean-stark trap. The benzene was then distilled off and the residue was redissolved in THF (2 mL) and added to BuLi (13.18 ml, 33.0 mmol) in THF (Volume: 30.000 ml) at 0 'C. The reaction mixture was stirred at 0 *C for 1 h before 5-bromo-1-pentene (5582 mg, 37.5 10 mmol) was added. The reaction mixture was stirred at 0 *C for 2hr. The mixture was cooled and quenched with water. The reaction mixture was extracted with diethyl-ether (3 x 20 mL). The combined organic fractions were washed with water and brine (saturated, 100 mL), dried, filtered and the solvent was evaporated under reduced pressure (400 inmhg). The residue was purified by column chromatography on silica gel to provide the title compound. 'H NMR (500 15 MHz, CDCl 3 ) 6 5.74-5.86 (m, 1H), 4.92-5.06 (m, 2H), 3.90-4.06 (m, 3H), 3.77-3.85 (m, 1H), 2.41-2.49 (m, iH), 2.16-2.24 (m, 1H), 2.01-2.12 (m, 2H), 1.72-1.97 (n, 2H), 1.31-1.49 (m, 3H). 3-methylidene-4-(pent-4-en-1-yl)tetrahydro-2H-pyran (5-3) 20 NaHMDS (5.35 ml, 10.70 mmol) was added to methyltriphenylphosphonium bromide (3822 mg, 10.70 mmol) in THF ( 53.500 ml) at RT. The reaction was stirred at RT for 1 hr before 4-(pent 4-en-1-yl)dihydro-2H-pyran-3(4H)-one (900 mg, 5.35 mmol) in THF (2 mL) was added at 0 'C. The reaction mixture was stirred at room temperature for 2 hr. The mixture was cooled and - 66 - WO 2011/043954 PCT/US2010/050493 quenched with aqueous NH 4 Cl. The reaction mixture was extracted with diethyl ether (3 x 20 mL). The combined organic fractions were washed with water and brine (saturated, 100 mL), dried, filtered and the solvent was evaporated under reduced pressure (400 mmhg). The residue was purified by column chromatography on silica gel to provide the title compound. 1H NMR 5 (500 MHz, CDC 3 ) b 5.75-5.89 (m, 1H), 4.92-5.06 (m, 2H), 4.86 (s, 11H), 4.77 (t, 1 H, J= 1.5 Hz), 4.12 (d, 1H, J= 12.1 Hz), 3.86-3.96 (m, 21), 3.57-3.65 (m, 1H), 2.15-2.24 (in, lH), 2.00-2.12 (in, 2H), 1.81-1.91 (m, 1H), 1.64-1.76 (m, 1H), 1.21-1.52 (m, 411). 3,4,4a,5,6,7-hexahydro-1H-isochromene (5-4) 10 3-methylidene-4-(pent-4-en- 1 -yl)tetrahydro-2H-pyran (1320 mg, 7.94 mmol) was added to CH2C12 (159.00 ml) at RT. The reaction was degased three times. Zhan-1b (58.3 mg, 0.079 mmol) was added at 0 'C. The reaction mixture was degased again and then stirred at room temperature for I h. The mixture was concentrated under reduced pressure (280 mmhg). The 15 residue was purified by column chromatography on silica gel to provide the title compound. 1H NMR (500 MHz, CDCl 3 ) a 5.54 (d, 1H, J = 2.2 Hz), 4.06 (d, 1H, J= 12.2 Hz), 3.97 (dd, 1H, J = 4.4 Hz, 11.2 Hz), 3.84-3.91 (m, 111), 3.46-3.53 (in, 1H), 2.21 (bs, 1H), 1.92-2.19 (in, 2H), 1.80 1.89 (m, 1H), 1.68-1.86 (in, 211), 1.36-1.48 (m, 2H), 1.16-1.26 (in, 111). 20 (laS,5aS)-hexahydro-4H-oxireno[i]isochromene (5-5) To a mixture of 3,4,4a,5,6,7-hexahydro-IH-isochromene (0.410 g, 2.97 mmol) in CH2Ci2 (10 mL) at 0 0 C was added MCPBA (~77%, 1.24 g, 445 mmol). The mixture was stirred at rt for 3 hr. It was quenched with sat'd aq. sodium sulfite. The mixture was diluted with CH 2 CI 2 and sat'd. 25 aq. NaHCO 3 then extracted 3x with CH 2 C 2 . The combined organics were dried (anhd, Na 2 SO4), filtered, and concentrated. The residue was purified by column chromatography to give the title compound. 1H NMR (500 MHz, CDC 3 ) a 4.03-4.10 (m, 1H), 3.86 (d, lH, J = 12.0 Hz), 3.54 3.62 (m, 11), 3.34 (d, 1H, J= 12.0 Hz), 3.03 (d, 1H, J= 4.4 Hz), 1.70-1.98 (m, 311), 1.52-1.65 (in, 311), 1.17-1.34 (m, 3H). 30 (4aS,8R,8aR)-8-[(4-fluorophenyl)amino]hexahydro-1H-isochromen-8a(3H)-o1 (5-6) To a mixture of 4-fluoroaniline (0.721 g, 6.48 mmol) in CH2CI2 (6 mL) at 0*C was added trimethylaluminum (2M in toluene, 3.24 mL) dropwise. The mixture was warmed and stirred to 35 r for 30 min. (laS,5aS)-hexahydro-4H-oxireno[i]isochromene (0.200 g, 1.30 mmol) in CH2Cl2 - 67 - WO 2011/043954 PCT/US2010/050493 2 mL +0.5 mL rinse) was then added and the mixture was stirred at rt overnight. The reaction was cooled to 0*C and treated with 50% NaOH (1 mL) then water (1 mL). The mixture was diluted with more water and extracted 3x with CH 2 01 2 . The combined organics were dried (anhd. Na 2 SO 4 ), filtered, and concentrated. The 5 residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDC1 3 ) 8 6.84-6.90 (m, 2H), 6.51-6.57 (m, 2H), 3.90-3.97 (in, 1H), 3.50-3.64 (in, 3H), 3.35-3.45 (m, 2H), 2.61 (s, 1H), 1.95-2.04 (m, 1H), 1.32-1.75 (m, 8H). HRMS (ES) m/z M+H calc'd: 266.1551, found: 266.1548. 10 TABLE # Structure MS M + 1 5-7 H 266.1549 0 HO HO| HN 5-8 266.1548 0C HO HN 5-9 H 284.1458 0 H HN F F 5-10 284.1456 0HO HN F - 68 - WO 2011/043954 PCT/US2010/050493 EXAMPLE 6 (4aR,5R,8aS)-5-[(4-fluorophenyl)aminojoctahydro-4aH-isochromen-4a-ol Example Scheme 6 1.) Ethylene glycol Cl.. Tosic: Acid, toluene Pd Pd 120C 0 O /a Cl 2) sO4, Na104, 0 0 HOXN0 THF, H 2 0 6-1 6-2 6-3 N OH H 1.) NaHMDS, THF 0 0 X antphos O0 'O 2.) NaBH 4 , LiCl THF, EtOH 1.) HOL, THFro 0.)0C , HF1.) Swern [0] O 2/Br 2) Br 0 6-6 6-5 6-4 NaHMDS, THF NaHMDS, THF MCPBA, 3.) Zhan-1b, CH 2 C 2 CH 2 CI 2 H H OAIMe, CH2C[2 O 5 6 XE 6 6 F- 6-8 WO 2011/043954 PCT/US2010/050493 3 -(prop-2-en- I -yl)tetrahydro-4H-pyran-4-one (6-2) A mixture of tetrahydro-4H-pyran-4-one (6-1) (5.17 g, 51.7 mmol), prop-2-en-1-ol (1.00 g, 17.2 mmol), allylPalladium Chloride dimer (0.157 g, 0.430 mmol), Xantphos (0.498 g, 0.861 mmol), and DL-proline (0.595 g, 5.17 mnmol) in DMSO (35 mL) was degassed (2xpump/N2) and heated 5 to 70'C overnight. The mixture was cooled to rt and partitioned between water and Et 2 0. Extracted with Et 2 O. The combined organics were washed with 1:1 brine:water, dried (anhd. Na 2 SO 4 ), filtered, and concentrated. The residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDCl 3 ) 5 5.70-5.80 (m, 1H), 5.01-5.09 (m, 2H), 4.13 4.22 (in, 2H), 3.72-3.79 (m, 1H), 3.43 (t, 1H, J= 11.2 Hz), 2.52-2.66 (in, 3H), 2.39-2.47 (in, 1H), 10 1.99-2.07 (m, 1H). 1,4,8-trioxaspiro[4.5]dec-6-ylacetaldehyde (6-3) A mixture of 3-(prop-2-en-1-yl)tetrahydro-4H-pyran-4-one (1.00 g, 7.13 mmol), ethylene glycol 15 (0.597 mL, 10.70 mmol) and p-toluenesulfonic acid monohydrate (0.136 g, 0.713 mmol) in toluene (30 mL) was heated to 120*C overnight. The reaction was then cooled to rt and concentrated. The residue was purified via column chromatography and used in the next step. To a mixture of 6-(prop-2-en-1-yl)-1,4,8-trioxaspiro[4.5]decane (0.840 g, 4.56 mmol) and osmium tetraoxide (2.5 wt % in T-BuOH,0.55 1 mL, 0.046 mrol) in THF (15 mL) and water (5 20 mL) at rt was added sodium periodate (2.15 g, 1.19 mmol) portionwise over 5 min. The mixture was stirred at rt for 2 hr. The reaction was then quenched with sat'd. aq. sodium sulfite. The mixture was extracted 3x with Et 2 O. The combined organics were dried (anhd. Na 2 SO 4 ), filtered, and concentrated. The residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDC 3 ) 8 9.71 (s, IH), 3.81-3.99 (m, 6H), 3.64-3.70 (m, 1H), 25 3.47 (dd, 1H, J = 8.6 Hz, 11.5 Hz), 2.49-2.57 (in, 2H), 2.18-2.26 (m, 1H), 1.65-1.82 (in, 2H). 4-(1,4,8-trioxaspiro[4.5]dec-6-yl)butan-1-ol (6-4) To a mixture of the methyl (diethoxyphosphoryl)acetate (0.938 g, 4.46 nmol) in dry THF (20 30 mL) under N 2 at 04C was added NaHMDS (2M in THF (1.98 mL, 3.96 mmol). The mixture was stirred for 30 minutes at 0 0 C. 1,4,8-trioxaspiro[4.5]dec-6-ylacetaldehyde (0.554 g, 2.98 mmol) - 70 - WO 2011/043954 PCT/US2010/050493 in dry THF (5 mL) was then added and the mixture was allowed to warm to rt and stirred for 1.5 hr. It was quenched with sat'd. aq. NH 4 CI and extracted 3x with Et 2 O. The combined organics were dried, filtered, and concentrated. The residue was purified via column chromatography and used in the next step. 5 To a mixture of methyl (2E)-4-(1,4,8-trioxaspiro[4.5]dec-6-yl)but-2-enoate (0.747 g, 3.08 mmol) in THF (9 mL) was added anhydrous LiCl (0.261 g, 6.71 mmol) and Sodium borohydride (0.233 g, 6.17 mmol). EtOH (12 mL) was then added slowly and the mixture was stirred at rt overnight. It was cooled to 0 0 C and quenched with 10% aqueous citric acid. The organic layer was then concentrated and the mixture was diluted with water and CH2Cl2. Extracted 3x with CH 2 Cl 2 . 10 The combined organics were dried (anhd. Na 2 SO 4 ), filtered, and concentrated. The residue was purified by column chromatography to give the title compound. iH NMR (500 MHz, CDCl 3 ) S 3.91-4.05 (in, 4H), 3.77-3.90 (m, 2H), 3.60-3.70 (m, 3H), 3.44 (dd, 11-1, J = 8.8Hz, 11.0 Hz), 1.14-1.82 (m, 9H). 15 6-(pent-4-en-1-yl)-1,4,8-trioxaspiro[4.5]decane (6-5) To a mixture of oxalyl chloride (2M in CH 2 C 2 , 1.17 ML, 2.34 mmol) in CH 2 Cl 2 (4 mL) at -78 0 C was added a mixture of DMSO (0.221 mL, 3.12 mrnol) in CH 2 Cl 2 (1 mL) dropwise. The mixture was stirred for 10 min. 3-(4-hydroxybutyl)tetrahydro-4H-pyran-4-one (0.337 g, 1.56 mmol) in CH 2 C 2 (3 mL +lmL rinse) was then added. The mixture was stirred for another 15 20 min and TEA (1.1 mL, 7.79 mmol) was added. The reaction was stirred for 10 more min at 78 0 C. The resulting mixture was warmed to rt and stirred for 30 minutes. It was quenched with water and sat'd aq. NaHCO 3 . Extracted 3x with CH 2 C1 2 . The combined organics were dried (anhd. Na 2 S0 4 ), filtered, and concentrated. The residue was purified by column chromatography and used in the next step. 25 To a mixture of methyltriphenylphosphonium bromide (0.920 g, 2.58 mmol) in THF (10 mL) under N2 at rt was added NaHMDS (2M in THF, 1.30 mL, 2.58 mmol). The mixture was stirred at rt for 1 hr. 4-(1,4,8-trioxaspiro[4.5]dec-6-yl)butana (0.276 g, 1.29 nunol) was then added and the reaction was stirred at rt for 1 hr. It was quenched with satd. aq. NH 4 Cl and extracted 3x with Et 2 O. The combined organics were dried (anhd. Na 2 SO 4 ), filtered, and concentrated. The 30 residue was purified by column chromatography to give the title compound. 'H NMR (500 MHz, CDCl 3 ) 6 5.75-5.86 (m, 111), 4.91-5.03 (in, 2H), 3.91-4.05 (m, 4H), 3.78-3.90 (in, 2H), 3.62-3.71 (m, 1H), 3.43 (dd, 1H, J = 9.0 Hz, 11.2 Hz), 1.98-2.12 (m, 2H), 1.11-1.81 (in, 7H). - 71 - WO 2011/043954 PCT/US2010/050493 3,4,6,7,8,8a-hexahydro-IH-isochromene (6-6) To a mixture of 6-(pent-4-en-1-yl)-1,4,8-trioxaspiro[4.5]decane (0.242 g, 1.14 mmol) in THF (3 mL) was added 10% HCl (3 mL) and stirred for 1 hr at rt. It was diluted with water and 5 extracted 3x with ether. The combined organics were washed with brine, dried, filtered and concentrated. The residue was used directly in the next step. To a mixture of methyltriphenylphosphonium bromide (0.849 g, 2.38 mmol) in THF (8 mL) under N2 at rt was added NaHMDS (2M in THF, 1.19 mL, 2.38 mmol). The mixture was stirred at rt for 1 hr. 3-(pent-4-en-1-yl)tetrahydro-4H-pyran-4-one (0.200 g, 1.19 mmol) in THF (2 mL 10 + 1 mL rinse) was then added and the reaction was stirred at rt for 1 hr. It was quenched with sat'd. aq. NH 4 CI and extracted with Ether. The combined organics were dried (anhd. Na 2 S0 4 ), filtered, and concentrated. The residue was further purified via column chromatography. A mixture of 4-methylidene-3-(pent-4-en-1-yl)tetrahydro-2H-pyran (0.198 g, 1.19 nimol) in CH. 2 C1 2 (20 mL) was degassed (3x N2/pump). Zhan-Ib (0.044 g, 0.060 mmol) was added, the 15 reaction was degassed again, and stirred at rt for 1 hr. The resulting mixture was concentrated and purified by silica gel chromatography to provide the title compound. 'H NMR (500 MHz, CDCl 3 ) 5 5.47 (s, 1H), 3.90-4.10 (m, 2H), 3.26-3.35 (m, 1H), 2.94 (t, 1H, J = 11.0 Hz), 2.24-2.40 (m, 2H), 1.74-2.07 (in, 311), 1.65-1.76 (in, 2H), 1.38-1.49 (m, 1H), 0.96-1.07 (in, 1H). 20 Octahydrooxirenoje]isochromene (6-7) To a mixture of 3,4,6,7,8,8a-hexahydro-IH-isochromene (0.120 g ,0.868 mmol) in CH2C12 (6 mL) at 0 0 C was added MCPBA (-77%, 0.300 g, 1.30 minmol). The mixture was stirred at rt for I hr. It was quenched with sat'd. aq. sodium sulfite. The mixture was diluted with CH 2 Cl 2 and 25 sa'td. aq. NaHCO 3 then extracted with CH 2 CI 2 . The combined organics were dried (anhd. Na 2 S04), filtered, and concentrated. The residue was purified by column chromatography to give the title compound. (4aR,5R,8aS)-5-[(4-fluorophenyl)amino]octahydro-4aH-isochromen-4a-ol (6-8) 30 To a mixture of 4-fluoroaniline (0.119 g, 1.07 mnnol) in CH2C12 (1 ML) at 0 0 C was added trimethylaluninun (2M in toluene, 0.535 mL) dropwise. The mixture was warmed to rt and stirred for 30 min. A mixture of cis and trans octahydrooxireno[e]isochromene (0.033 g, 0.214 - 72 - WO 2011/043954 PCT/US2010/050493 mmol) in CH2CJ2 (1 mL) was then added and the mixture was stirred at rt overnight. The reaction mixture was cooled to 0 0 C and treated with 50% NaOH (1 mL) then water (1 mL). It was diluted with more water and extracted 3x with CH 2 Cl2. The combined organics were dried, filtered and concentrated. The residue was purified by column chromatography to give the title 5 compound. 1H NMR (500 MHz, CDC1 3 ) 5 6.92 (t, 2H, J = 8.8 Hz), 6.71 (dd, 2H, J = 4.2 Hz, 8.8 Hz), 3.81-3.87 (m, 1Ff), 3.61 (dd, 1H, J = 4.6 Hz, 11.2 Hz), 3.50 (t, 1H, J = 11.0 Hz), 3.32 (s, 1H), 2.15-2.26 (m, 1H), 1.89-2.07 (in, 2H), 1.59-1.69 (m, 2H), 1.45-1.58 (in, 1H), 1.20-1.37 (in, 4H). HRMS (ES) m/z M+H calc'd.: 266.1551 found: 266.1549 10 TABLE 6 # Structure MS M + 1 6-9 H 266.1549 '-HOY HN F <F 6-10 H 248.1646 HO HN N 6-11 H 284.1458 H O HN F F 15 EXAMPLE 7 (4aS,5R,8aR)-5-[(4-fluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-o -73 - WO 2011/043954 PCT/US2010/050493 Reaction Scheme 7 O DIBAL-H HO] o 1diglyme OH 7-1 7-2 6 M aq. HeI diglyme AN185 C HH 2 N H H 0 ~ 0 H mCPBA 0 I. + -CH 2 01 2 HO A1Me 3 ,C 2 CI 2 _ 7HN 7-5 7-4 7-3 ethyl 3-(6-oxocyclohex-1-en-1-yl)propanoate (7-2) 5 Compound 7-2 and compound 7-3 were made according to literature reference (Yeh, M-C; Lee, Y-C, Young, T-C, Synthesis, 2006, 21, 3621-3624). To a solution of 5 mL of cyclohex-2-en-1 one in 100 mL 1,3-dimethyl-2-imidazolidinone (DMEU) was added 7.4 mL ethyl acrylate followed by 4 mL 2,3,4,6,7,8,9,10-octahydropyrimido[1,2-a]azepine (DBU). The reaction was 10 heated to 185 'C in a sealed tube overnight, then cooled to RT and added to water. The resultant mixture was extracted with Et 2 O, and the crude extract was dried over Na 2 SO 4 then filtered, concentrated, and purified on silica (0-60% Et 2 O in hexanes) to provide the title compound. 3,4,6,7,8,8a-hexahydro-2H-chromene (7-3) 15 A solution of 48 mL diisobutylaluminum hydride (1.0 M in cyclohexane) was cooled to -78 *C and a solution of 2.335 g ethyl 3-(6-oxocyclohex-1-en-1-yl)propanoate in 48 mL THF was added. The reaction was warmed to 0 *C and stirred for one hour, then warmed to RT and stirred for one more hour. The reaction was not complete at this point, so 10 mL additional 20 diisobutylaluminum hydride solution was added the reaction was and stirred at RT for two hours. The reaction was then cooled to -78 'C and then 25 mL 6 M HCI was added dropwise. After the addition was complete, the reaction was allowed to return to RT and was stirred overnight. The reaction was diluted with 200 mL Et 2 O then washed 2X with water, then with brine. The organic - 74- WO 2011/043954 PCT/US2010/050493 layer was dried over Na2SO4 then filtered, concentrated, and purified on silica gel to provide the title compound. (laS,4aS,8aS)-hexahydro-1aH,6H-oxireno[ejchromene (7-4) and (1 aS,4aR,8aS)-hexahydro 5 laH,6H-oxireno[e]chromene (7-5) Dissolved 431 mg 3,4,6,7,8,8a-hexahydro-2H-chromene in 12.5 mL CH 2 C2 then added 700 mg meta-chloroperoxybenzoic acid (77% pure) and stirred for several hours. TLC shows two products. Quenched excess oxidant with saturated sodium sulfite, diluted with water, then 10 extracted with CH 2 CI 2 and dried extract over Na 2 SO 4 . Filtered, concentrated, then purified on silica gel to yield the individual title compounds. Compound 7-4: 'H NMR (500 MHz, CDCl 3 ) 6 = 1.26-1.31 (m, 1H), 1.42-1.46 (m, 11H), 1.49-1.58 (m, 2H), 1.65-1.72 (m, 1H), 1.76-1.88 (m, 3H), 1.95-2.03 (m, 2H), 3.05 (d, J= 4.9 Hz, 1H), 3.49 (td, J1 = 11.5 Hz, J 2 = 2.9 Hz, 1H), 3.72 3.74 (in, 1H), 3.97-4.01 (m, 1H) ppm. (7-5) 'H NMR (500 MHz, CDC13) S= 1.21-1.31 (in, IH), 15 1.34-1.39 (m, 1H), 1.47-1.69 (in, 4H), 1.77-1.88 (m, 2H), 2.01-2.13 (in, 2H), 3.07 (d, J= 3.9 Hz, 1H), 3.60-3.66 (m, 2H), 4.05-4.09 (in, 1H) ppm. (4aS,5R,8aR)-5-[(4-fluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-ol (7-6) Dissolved 55 uL 4-fluoroaniline in 1.3 mL CH2C12 then cooled to 0 'C and added 0.21 mL 20 AlMe 3 (2.OM in toluene). Warmed to RT, stirred for 30 minutes, then added 50 mg (laS,4aR,8aS)-hexahydro-laH,6H-oxireno[e]chromene (7-5) in 1.0 mL CH2C12. Stirred for two hours at RT, then sat. sodium potassium tartrate solution was added dropwise to the reaction, allowing gas evolution to cease between drops, until no further gas evolution was noted. The mixture was diluted with water, then extracted with CH 2 C1 2 . The extract was dried over Na 2 SO 4 , 25 filtered, concentrated, then purified on silica (0-40% EtOAc in hexanes) to yield the title compound. '1H NMR (500 MHz, CDCl 3 ) 6 = 1.42-1.69 (in, 7H), 1.90-2.09 (in, 3H), 2.47 (s, 1H), 3.38-3.48 (in, 311), 3.53 (s, broad, IH), 3.92-3.95 (in, 1H), 6.54-6.59 (m, 2H), 6.84-7.26 (m, 2H) ppm. HRMS (ES) m/z M+H calc'd: 266.1551; found 266.1551. 30 TABLE7 # Structure MS M +1 - 75 - WO 2011/043954 PCT/US2010/050493 7-7 o H 266.1551 HO HN 7-8 266.1552 HN 7-9 0 H 284.1454 HO HN F 7-10 0 284.1454 HO6 HN F F EXAMPLE 8 (4aR,5R,8S,8aR)-5-[(4-fluorophenyl)amino]-8-(methoxymethyl)hexahydro-2H-chromen-4a(5H) 5 ol - 76 - WO 2011/043954 PCT/US2010/050493 / Br O A 01LOA THF ynHkCA 2 8-1 8-2 NaBH4; MeoH AOTBDPS oATBDPS OH CPBA 0 1)NaHTHF 0 CHC22) TBDPS-J- I 8-6 8-5 8-4 H 2 N j AlMs oTBDPS OH TBAF 1)NaH THF HOF(: 2) Mel HO HN H H NN, H N , HN ,O IH1fl 8-7 8-8 8-9 5-ethenyl-3,4-dihydro-2H-pyran (8-2) A solution of 21.0 g methyltriphenylphosphonium bromide in 120 mL THF was cooled to 0 C 5 and added 30 mL lithium diisopropylamide (2.0 M in THF) and stirred for one hour at 0 C. 5.09 g 3,4-dihydro-2H-pyran-5-carbaldehyde in 5 mL THF was then added slowly via syringe to the reaction mixture, and the reaction was warmed to RT and stirred overnight. The reaction was added to water, extracted w/ petroleum ether and dried over Na 2 S04. Subsequent cooling in a freezer for several hours caused much of the triphenylphosphine oxide to crystallize out of 10 solution, and the drying agent and phosphine byproduct were removed by filtration. The solution was concentrated in vacuo, and the remaining crude mixture was distilled at reduced pressure to afford the title compound. . 1 H NMR (500 MHz, CDCl 3 ) 6 = 1.89-1.94 (m, 2H), 2.15 (t, J= 6.3 Hz, 2H), 3.99 (t, J= 5.1 Hz, 2H), 4.77 (d, J= 10.7 Hz, 1H), 4.90 (d, J= 17.3 Hz, 1H), 6.24 (dd, Ji = 17.3 Hz, J2 = 10.7 Hz, IH), 6.57 (s, 1H) ppm. 15 (8R,8aR)-3,4,6,7,8,8a-hexahydro-2H-chromene-8-carbaldehyde (8-3) - 77 - WO 2011/043954 PCT/US2010/050493 A mixture of 2.613 g 5-ethenyl-3,4-dihydro-2H-pyran and 8.9 mL acrolein (90% pure) was dissolved in 39 mL CH 2 Cl 2 and stirred overnight at RT. The reaction was added to water and extracted with CH 2 C1 2 . The crude extract was filtered, concentrated using a rotovap, then purified on silica gel to provide the title compound. 1H NMR (500 MHz, CDCl 3 ) 8 = 1.64-1.98 5 (m, 5H), 2.04-2.16 (in, 1H), 2.23-2.29 (in, IH), 2.34-2.38 (in, 1H), 2.60-2.64 (m, IH), 3.55-3.61 m, 1H), 3.99-4.04 (m, TH), 4.21 (d, J= 5.6 Hz, lH), 5.55 (s, lH), 9.88 (s, 1H) ppm. (8S,8aR)-3,4,6,7,8,8a-hexahydro-2H-chromen-8-ylmethanol (8-4) 10 202 mg (8R,8aR)-3,4,6,7,8,8a-hexahydro-2H-chromene-8-carbaldehyde was disscilved in 8 mL MeOH and the solution was cooled to 0 'C and 52 mg sodium borohydride was added slowly. The reaction was stirred for several hours and gradually warmed to RT. The methanol was removed using a rotovap and the residue was diluted with CH 2 C 2 and added to sat. NH 4 CI. The mixture was separated, and the aqueous was extracted with CH 2 C1 2 . The crude extract was dried 15 over Na 2 SO 4 , filtered, concentrated, then purified on silica gel to provide the title compound. 'H NMR (400 MHz, CDCl 3 ) 6 = 1.46-1.80 (in, 4H), 1.84-2.10 (in, 3H), 2.13-2.38 (in, 2H), 2.78 2.86 (in, 1H), 3.52-3.62 (in, IH), 3.66-3.76 (in, 1 H), 3.76-3.87 (in, IH), 3.94-3.47 (in, 2H), 5.52 (s, 1H) ppm. 20 tert-butyl[(8S,8aR)-3,4,6,7,8,8a-hexahydro-2H-chromen-8-ylmethoxy]diphenylsilane (8-5) To a solution of 360 mg (8S,8aR)-3,4,6,7,8,8a-hexahydro-2H-chromen-8-ylmethanol added 2.2 mL DMF, then 224 mg imidazole followed by 0.66 mL tert-butyl(chloro)diphenylsilane. The 25 reaction was stirred overnight at RT, then added to water and extracted with diethyl ether. The crude extract was dried over Na 2 S04, filtered, concentrated, then purified on silica gel to provide the title compound. 'H NMR (500 MHz, CDCl 3 ) 6 = 1.05 (s, 9H), 1.37-1.46 (m, 1H), 1.54-1.58 (m, IH), 1.63-1.73 (in, 2H), 1.86-2.09 (m,3H), 2.16-2.24 (in, 1H), 2.25-2.31 (m, IH), 3.53 (in, 1H), 3.60 (dd, J, = 9.8 Hz, J2= 7.7 Hz, IH), 3.80 (d, J= 5.1 Hz, IH), 3.90 (dd, Ji = 10.0 Hz, J2 30 = 7.4 Hz, 1H), 3.94-3.98 (in, 1H), 4.49-5.52 (in, IH), 7.35-7.42 (in, 6H), 7.67-7.72 (n, 4H) ppm. tert-butyl[(1aR, 4S, 4aR,8aR)-hexahydro-l aH,6H-oxireno[e]chroinen-4 ylmethoxy]diphenylsilane (8-6) -78- WO 2011/043954 PCT/US2010/050493 Dissolved 424 mg tert-butyl[(8S,8aR)-3,4,6,7,8,8a-hexahydro-21J-chromen-8 ylmethoxy]diphenylsilane in 10 mL CH 2 C 2 then added 264 mg meta-chloroperoxybenzoic acid and stirred at RT overnight. Quenched excess oxidant with saturated sodium sulfite, diluted with water, then extracted with CH 2 CI 2 and dried extract over Na 2 SQ 4 . Filtered, concentrated, then 5 purified on silica gel to provide the title compound. 1H NMR (500 MHz, CDCl 3 ) 8 = 1.05 (s, 9H), 1.16-1.22 (m, 1H), 1.24-1.34 (m, 1H), 1.42-1.46 (m, 1H), 1.76-1.91 (m, 2H), 1.99-2.11 (m, 2H), 3.04 (d, J= 5.1 Hz), 3.38-3.48 (in, 2H), 3.68 (t, J= 9.0 Hz), 3.87 (d, J= 2.9 Hz), 3.94-3.98 (in, 1H), 7.35-7.43 (m, 6H), 7.64-7.69 (in, 4H) ppm. 10 (4aR,5R,8S,8aR)-8-({ [tert-butyl(diphenyl)silyl]oxy}methyl)-5-[(4 fluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-ol (8-7) Dissolved 114 uL I in 2.4 mL CH 2 CI 2 then added 0.59 mL trimethylaluminum (2.0 M in 15 toluene). Stirred for 45 minutes then added 100 mg tert-butyl[(laS,4aR,8aS)-hexahydro-laH,6H oxireno[e]chromen-4-ylmethoxy]diphenylsilane in 0.50 mL CH 2 CI 2 . The reaction was stirred overnight at RT, then sat. sodium potassium tartrate solution was added dropwise to the reaction, allowing gas evolution to cease between drops, until no further gas evolution was noted. The mixture was diluted with water, then extracted with CH 2 Cl 2 . The extract was dried over Na 2 SO 4 , 20 filtered, concentrated, then purified on silica gel to provide the title compound. 'H NMR (500 MHz, CDCl 3 ) 8 = 1.05 (s, 9H), 1.26-1.33 (in, 3H), 1.56-1.65 (in, 2H), 1.71-1.76 (m, 1H), 1.78 1.86 (m, 1H), 2.11-2.16 (in, 1H), 2.21-2.28 (in, 1H), 2.32-2-42 (m, 1H), 3.40-3.48 (in, 2H), 3.52 3.57 (in, 2H), 3.76 (t, J= 9.0 Hz, 1H), 4.07 (dd, J, = 11.5 Hz, J 2 = 5.4 Hz, 1H), 4.58 (d, J= 11.5 Hz), 6.48-6.52 (ni, 2H), 6.84-6.88 (m, 2H), 7.36-7.44 (m, 6H), 7.68-7.71 (m, 4H) ppm. 25 (4aR,5R,8S,8aR)-5-[(4-fluorophenyl)amino]-8-(hydroxymethyl)hexahydro-2H-chromen-4a(5H) ol(8-8) Dissolved 68 mg (4aS,5R,8S,8aR)-8-({[tert-butyl(diphenyl)silyl]oxy}methyl)-5-[(4 30 fluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-ol in 4 mL tetrabutylammoniun fluoride solution (2.0 M in THF) and stirred overnight at RT. Excess solvent was removed using a rotovap, then the residue was diluted with CH 2 Cl 2 , added to water, and extracted with CH 2 Cl 2 . The crude extract was dried over Na 2 SO 4 , filtered, concentrated, then purified on silica gel to provide the title compound. 'HNMR (500 MHz, CDCl 3 ) 8 = 1.32-1.39 (m, 1H), 1.55-1.90 (in, - 79- WO 2011/043954 PCT/US2010/050493 5H), 2.06-2.16 (in, 2H), 2.24-2.28 (m, IH), 2.34-2.46 (m, 1H). 3.46 (s, iH), 3.49-3.56 (in, 2H), 3.68-3.75 (m, IH), 3.77-3.82 (m, 1H), 4.12 (dd, Ji = 11.4 Hz, J 2 = 6.0 Hz, IH), 4.64 (d, J= 11.2 Hz), 6.50-6.56 (in, 2H), 6.85-6.90 (m, 2H) ppm. 5 (4aR,5R,8S,8aR)-5-[(4-fluorophenyl)amino]-8-(methoxymethyl)hexahydro-2H-chromen-4a(5H) ol (8-9) Dissolved 95 mg (4aS,5R,8S,8aR)-5-[(4-fluorophenyl)amino]-8-(hydroxymethyl)hexahydro-2H chromen-4a(5H)-ol in 2.1 mL THF then added 39 mg NaH. The reaction was stirred for 1.5 10 hours at RT, then diluted with an additional I mL of THF before adding 50 uL iodomethane. The reaction was stirred overnight at RT, then added to sat. NH 4 C1. The mixture was diluted with water and extracted with CH 2 C 2 . The crude extract was dried over Na 2 SO 4 then filtered, concentrated, then purified on silica gel to provide the title compound. H NMR (500 MHz, CDCl 3 ) 5 = 1.34-1.40 (in, 2H), 1.54-1.62 (m, 2H), 1.72-1.77 (m, iH), 1.78-1.87 (i, iH), 2.10 15 2.16 (m, IH), 2.22-2.30 (m, IH), 2.32-2.42 (in, IH), 3.29 (dd, Ji = 9.3 Hz, J 2 6.6 Hz, IH), 3.31-3.33 (m, IH), 3.44-3.50 (in, 2H), 3.53 (bd, J=11.2 Hz), 4.09 (dd, Ji = 11.6 Hz, J 2 = 6.5 Hz, iH), 4.58 (d, J= 11.2 Hz) ppm. HRMS (ES) m/z M+H calc'd: 310.1813; found 310.1811. TABLE 8 20 # Structure MS M + 1 8-10 F 310.1811 H OMe 8-11 F 324.1968 C H OMe - 80 - WO 2011/043954 PCT/US2010/050493 8-12 F 338.1763 HO N 0 0 0 8-13 F 386.4 N HO~r 0 8-14 HH F 354.4 HO H N 0 While the invention has been described and illustrated with reference to certain particular embodiments thereof, those skilled in the art will appreciate that various adaptations, changes, modifications, substitutions, deletions, or additions of procedures and protocols may be 5 made without departing from the spirit and scope of the invention. For example, effective dosages other than the particular dosages as set forth herein above may be applicable as a consequence of variations in the responsiveness of the mammal being treated for any of the indications with the compounds of the invention indicated above. Likewise, the specific pharmacological responses observed may vary according to and depending upon the particular 10 active compounds selected or whether there are present pharmaceutical carriers, as well as the type of formulation and mode of administration employed, and such expected variations or differences in the results are contemplated in accordance with the objects and practices of the present invention. It is intended, therefore, that the invention be defined by the scope of the claims which follow and that such claims be interpreted as broadly as is reasonable. 15 - 81 - WO 2011/043954 PCT/US2010/050493 Biological Examples High Throughput Calcium Imaging Assay The assay was dependent on detecting the change in intracellular Ca2+ 5 concentration following activation of the channel in cells stably expressing the TRPAl channel. Activation of the TRPAl channel was followed by Ca2+ influx. Ca2+ increase was quantified through the use of a fluorescent Ca2+ indicator that was loaded into the cells. Compounds which inhibited Ca2+ increase were considered "hits" warranting additional examination. The HEK293 FlpIn cell line (Invitrogen) was stably transfected as per the 10 manufacturers guidelines with a construct encoding a human TRPAI protein with the amino acid sequence depicted in SEQ ID NO: 1. The resulting cell line was maintained in the growth medium recommended by the manufacturer and supplemented with 1 00ug/mL Hygromycin B to promote the selection of cells stably expressing the TRPAl channel. After growing to confluency, cells were plated at a density of 24,000 cells/well in 384 well Black/Clear Microtest 15 plates (Falcon) in the recommended growth medium supplemented with hygromycin, and allowed to grow for 20-24 hours resulting in a -90% confluent monolayer of cells. Cells were then loaded with assay buffer containing the Ca2+ dye Fluo-4AM (Invitrogen) to a final concentration of 4uM, and incubated for 60 minutes at room temperature in the dark. The assay buffer consisted of 138mM NaCl, 5.33mM KCl, 1.26mM CaCl2, 0.49mM MgCl2, 0.41mM 20 MgSQ4 5.56mM D-glucose, 0.44mM KH2PO4, 0.34mM Na2HPO4, 20mM HEPES, 2.5mM Probenecid, and 4% TR-40; pH 7.8. Following 1 hour dye loading, cells were assayed using the FLIPR TETRA (Molecular Devices) which permits excitation of the Fluo-4AM dye, and subsequent recording of emission spectra according to the manufacturer's guidelines. A total of 5 baseline readings were acquired prior to each reagent addition, after which, readings were 25 acquired at a rate of 1 every 3 seconds for 195 seconds, and then 1 every 10 seconds for an additional 420 seconds. During the assay, reagents were added and mixed after each addition by the FLIPR TETRA pippetor. EC60 concentration of Cinnamaldehyde was determined before the screening assay, and used as the activating concentration henceforth. For the screening assay, the baseline reading was taken, followed by addition of 1 OuL of a compound stock at six-times the 30 final concentration, followed by 615 seconds of read time as previously described. Following - 82 - WO 2011/043954 PCT/US2010/050493 baseline readings, 1OuL of six-times final concentration Cinnamaldehyde was added to each well, achieving a final concentration of I OuM compound, and on average, 12uM Cinnamaldehyde (depending on the EC60 derived during that experiment). Following addition of Cinnamaldehyde, readings were taken for 615 seconds as previously described. Negative 5 controls consisted of HEK293 FlpIn TRPAI cells exposed to compound vehicle and then Cinnamaldehyde. Positive controls consisted of HEK293 FlpIn TRPA I cells exposed to a concentration of reference antagonist capable of fully blocking the response to Cinnamaldehyde. "Hits" were identified as compounds which inhibited the fluorescence response in the presence of Cinnamaldehyde as compared to the negative and positive controls. IC50 values were 10 determined for compounds defined as "hits" which reached fully inhibition . This cell-based fluorescence assay was used to determine Ca2+ influx through the channel in the presence of compound at the following concentrations: lOuM, 3.33uM, 1.1 luM, 0.37uM, 0.12uM, 0.04luM, 0.014uM, 0.0046uM, 0.0015uM, and 0.0005luM. Highly potent "hits" were also investigated at 10OOnM, 333.33nM, 111.11M, 37.04nM, 12.35nM, 4.12nM, 1.37nM, 0.46nM, 15 0.15nM, and 0.05nM. [SEQ ID. NO: 1] 20 Human TRPAI - NM_007332.1 MKCSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLK TCDDMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKF LLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTT 25 NNSEALQILLNKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFM NNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISS YSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASAS WNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDND GCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDJSDT 30 RLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQT - 83 - WO 2011/043954 PCT/US2010/050493 MKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLA LHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLIISTED KSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLL MKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSY 5 LIKTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQ WQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILL NLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNL LIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGG MLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISET 10 EDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP The TRPAI antagonists of this invention were found to have IC50's for inhibition of human TRPAI of 100 micromolar or less, in some cases 50 micromolar or less, in some cases 20 micormolar or less, in some cases 10 micromolar or less, in some cases 5 micromolar or less, 15 in some cases 2 micromolar or less, in some cases 1 micromolar or less, in some cases 500 nanomolar or less, in some cases 250 nanomolar or less, in some cases 200 nanomolar or less, in some cases 100 nanomolar or less, and in some cases 20 nanomolar or less. In certain embodiments, the TRPA I antagonists of this invention inhibit one or both of inward and outward TRPA1 -mediated current with an IC50 of 100 micromolar or less, in some cases 50 20 micromolar or less, in some cases 20 micormolar or less, in some cases 10 micromolar or less, in some cases 5 micromolar or less, in some cases 2 micromolar or less, in some cases I micromolar or less, in some cases 500 nanomolar or less, in some cases 200 nanomolar or less, and in some cases 100 nanomolar or less, in some cases 50 nanomolar or less and in some cases 20 nanomolar or less. In certain embodiments, the TRPA1 antagonist inhibits at least 95% of 25 TRPAI-mediated current or TRPA1-mediated ion flux when administered at 5 micromolar or less, and even more preferably at 1 micromolar or less. Ideally TRPAI inhibitors of the claimed invention have an IC50 for TRPA1 inhibition that, at that concentration, does not cause QT interval elongation in the patient nor alter temperature regulation in the patient. - 84 - WO 2011/043954 PCT/US2010/050493 In certain embodiments, the pharmaceutical composition comprises an effective amount of any of the compound of formula I, wherein the compound inhibits TRPA1 (e.g., a TRPAI mediated current and/or TRPAI -mediated ion flux) with an ICsO of 10 micromolar or less. For example, in Table C below nanomolar IC50 values were observed. 5 TABLE C F TRPA1 hFLIPR IUPAC name IC50 (nM) N HO 19 (4aR,8aR)-4-[(4 fluorophenyl)amino]octahydronaphthalen-4a(2H)-o HO HO HNl 54 (4R,4aR,8aR)-4-(phenylamino)octahydronaphthalen 5 4a(2H)-ol F HN Fr HO N 35 (4aR,5S)-5-{(4-fluorophenyl)amino]-8 (methoxymethyl)hexahydro-2H-chromen-4a(5H)-ol H OMe F HO F 850 (4aR,5S,8aS)-5-{(4-fluorophenyl)amino]hexahydro-2H (0 -chromen-4a(5H)-ol H F HO N 520 (4aS,5R,8aS)-5-[(4-fluorophenyl)amino]hexahydro-2H Ot chromen-4a(5H)-ol H - 85 -
权利要求:
Claims (21) [1] 1. A compound represented by Formula I: Rk N'R 4 N L)x 5 zY W I or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its saltwherein: W represents CH2, NC(O)R 4 , NC(O)NR 3 R 4 , NR 4 , CHR 4 , -0 10 U, X, Y, and Z independently represent CH2, or -0-; R 2 represents hydrogen, or C1-6 alkyl; 15 R 5 represents hydrogen, or C1 -6 alkyl, C(O)N(R 2 )2, C(O)R 2 , C(O)O(CH2)nC6- 10 aryl, (CHR 2 )nC5-10 heterocyclyl, (CHR 2 )nC6-10 aryl; said alkyl, heterocyclyl and aryl optionally substituted with 1 to 3 groups of Ra; 20 R 3 and R 4 independently represent H, (CH2)nOR 2 , (CH2)nOR 5 , CH(OR 2 )2, CH20(CH2)nOR, CHF2, (CH2)nNR 2 R5, (CHR 2 )nC5-10 heterocyclyl, (CHR 2 )nC6-10 aryl, (CHR 2 )nC3-10 cycloalkyl, C1-6 alkoxy, C2-6 alkenyl, CF3, CHF2, CH20Si(C5-6 aryl)2R 2 , C(0)1-2R 2 , or Cl 6 alkyl; said alkyl, cycloalkyl, heterocyclyl and aryl optionally substituted with I to 3 groups of Ra; 25 or R3 and R 4 can be combined with the nitrogen to which they are attached to form a C5-10 heterocyclyl optionally containing one or more additional heteroatoms selected from 0, N, and S and optionally substituted with I to 3 groups of Ra; - 86 - WO 2011/043954 PCT/US2010/050493 Ra represents C1-6 alkyl, halogen, hydroxyl, OR 2 , (CH2)nCF3, C3.-6 cycloalkyl, C(O)N(R2)2, C(R 2 )20R 2 , C(O)R 2 , N02, CN, N(R 2 )2, C(O)OR 2 , (CH2)nC5-10 heterocyclyl, or (CH2)nC6 10 aryl, said heterocyclyl and aryl optionally substituted with 1 to 3 groups of C 1-6 alkyl, halogen, hydroxyl, (CH2)nCF3,or CN; and 5 n represents 0 to 4. [2] 2. The compound according to claim 1 wherein R 5 is hydrogen, one of R 3 and R 4 is hydrogen, or CH3, and the others selected from the group consisting of H, 10 (CHR 2 )nC5-10 heterocyclyl, (CHR 2 )nC6-10 aryl, (CHR 2 )nC3-10 cycloalkyl, or CP-6 alkyl; said alkyl, cycloalkyl, heterocyclyl and aryl optionally substituted with I to 3 groups of Ra. [3] 3. The compound according to claim 2 wherein W is CHR 4 , -O-, or NC(O)R 4 , and U, Z, Y and X are CH2. [4] 4. The compound according to claim 2 wherein Y is -0-, and W, U, Z and X 15 are CH2. [5] 5. The compound according to claim 3 wherein W is CHR 4 . [6] 6. The compound according to claim 3 wherein W is CH2, or -0-. [7] 7. The compound according to claim 1 represented by structural formula Ia: (R')0.3 (CHR')n HN OH R 4 20 la or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt, -87 - WO 2011/043954 PCT/US2010/050493 wherein R 4 is selected from the group consisting of H, (CH2)nOR 2 , CH(OR 2 )2, and CH2Si(C5-6 aryl)2R 2 ., Ra is selected from the group consisting of C1-6 alkyl, halogen, CN, OR 2 , (CH2)nCF3, C3-6 cycloalkyl, (CH2)nC5-10 heterocyclyl, or (CH2)nC6-10 aryl, said heterocyclyl and aryl optionally substituted with 1 to 3 groups of C1 -6 alkyl, halogen, hydroxyl, 5 (CH2)nCF3,or CN and R 2 if present is hydrogen. [8] 8. The compound according to claim 7 represented by structural formulas Ib: (CHR2) OH " R4 lb 10 or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt,wherein Ra and n are as described herein. [9] 9. The compound according to claim 1 represent by structural formula Id: (R*)0-3 (CHR2)n HN OH N Id 15 - 88 - WO 2011/043954 PCT/US2010/050493 or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt, wherein Ra, R 3 and R 4 and n are as originally described and R 5 is R 4 or -NR 3 R 4 and R 2 if present, is hydrogen. [10] 10. The compound according to claim 1 represented by structural formula Ie: 5 (CHR 2 )n HN OH Y W Ie or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or 10 prodrug of the compound or its salt,, wherein R 2 , Ra and n are as originally described, W is CHR 4 , or -0-, Y is CH2 or -0-, and R 4 is selected from the group consisting of H, (CH2)nOR 2 , CH(OR 2 )2, and CH2OSi(C5-6 aryl)2R 2 , provided that both Y and-W are not -0 at the same time, and R 2 , if present, is hydrogen. 15 [11] 11. The compound according to claim I represented by structural formula If: (CHR2)n HN OH U I x If - 89 - WO 2011/043954 PCT/US2010/050493 or a pharmaceutically acceptable salt thereof, a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt,, wherein Ra and n are as described herein, and U, X, and Z 5 are independently selected from CH2 or -0-, provided that only one of U, X, and Z can be -0 at any given time. [12] 12. A compound which is: (4aR,8aR)-4-[(4-fluorophenyl)aminojoctahydronaphthalen-4a(2Hkol, 10 (4aR,8aR)-4-[(3,4-difluorophenyl)amino]octahydronaphthalen-4a(2H)-ol, 2,3-dihydro-1H-inden-1-yl[(4aS,8aS)-4a-hydroxy-4-(phenylamino)octahydroquinolin-1(2H) yl]methanone, (4aS,8aS)-N-(4-fluorophenyl)-4a-hydroxy-4-(phenylamino)octahydroquinoline- 1(2H) carboxamide, 15 (4aS,8aS)-4a-hydroxy-4-(phenylamino)-N-(propan-2-yl)octahydroquinoline-1(2H)-carboxamide, [(4aS,8aS)-4a-hydroxy-4-(phenylamino)octahydroquinolin- I (2H)-yl](phenyl)methanone, [(4aS,8aS)-4a-hydroxy-4-(phenylamino)octahydroquinolin- I (2H)-yl] (tetrahydro-2H-pyran-4 yl)methanone, (4aS,8aS)-4a-hydroxy-N-phenyl-1-(3,3,3-trifluoropropanoyl)decahydroquinolin-4-aminium 20 trifluoroacetate, I-[(4aS,8aS)-4a-hydroxy-4-(phenylamino)octahydroquinolin- I(2H)-yl] -3 -methylbutan- 1-one, 1- [(4aS, 8aS)-4a-hydroxy-4-(phenylamino)octahydroquinolin- I (2H)-yl]pentan- 1-one, 1- [(4aS,8aS)-4a-hydroxy-4-(phenylamino)octahydroquinolin- I (2H)-yl]ethanone, (4aS,8aS)-1-benzyl-4-(phenylamino)octahydroquinolin-4a(2H)-ol, 25 (4aR,8aR)-4-(cyclopropylamino)octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-(propan-2-ylamino)octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-[(2,4,6-trifluorophenyl)amino]octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-[(2,4,5-trifluorophenyl)amino]octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-[(3,4,5-trifluorophenyl)amino]octahydronaphthalen-4a(2H)-ol, 30 (4aR,8aR)-4-[(2,3,5-trifluorophenyl)aminojoctahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-[(2,3,4-trifluorophenyl)amino]octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-[(3,5-difluorophenyl)amino]octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-[(3,4-difluorophenyl)amino]octahydronaphthalen-4a(2H)-ol, -90- WO 2011/043954 PCT/US2O1O/050493 (4aR,8aRj-4- [(2,6-difluorophenyl)amino] octahydronaphthalen-4a(2I)-ol, (4aR,8aR)-4-[(2, 5-difluorophenyl)amino~octahydronaphthalen-4a(2H)-ol, (4aR, 8aR)-44 (2, 3 -difluorophenyl)aminoj octahydronaphthalen-4a(2Hy-ol, (4aR,SaR)-4-[(4-fluorophenyl)amino] oetahydronaphthalen-4a(2H)-ol, 5 (4aR,8aRj-4-[(3-fiuorophenyl)amnino] octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-[(2-fiuorophenyl)amino] octahydronaphthalen-4a(2Hfrol, (4aR,8aR)-4- { [4-( 1H-tetrazol-5-yl)phenyl] amino)I octahydronaphthalen-4a(2I)-ol, (4aR, 8aR)-4- {[3 -(1 Ft-tetrazol-5-yl)phenyl] amino)I octahydronaphthalen-4a(2H)-ol, (4aR, 8aR)-4- { [2-( I f-tetrazol-5-yl)phenyl] amino)I octahydronaphthalen-4a(2H)-oI, 10 4-(phenyLamino)octahydronaphthalen-4a(2H)-oI, 4-{phenylamino)octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-( 1H-indol.-7-ylamino)octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-(biphenyt-4-ylamino)octahydronaphthalen-4a(2H)-ol, (4aR, SaR)-4-(biphenyl-3 -ylamino)octahydronaphthalen-4a(2H)-ol, 15 ethyl 3- {[(4aR,SaR)-Sa-hydroxydecahydronaphthalen- l -yI] amino) -1A H-indole-2-carboxylate, (4aR,SaR)-4-( IH.-indol-4-ylamino)octahydronaphthalen-4a(2H)-ob, (4aR,8aR)-4-(quinolin-8-ylamnino)octahydronaphthalen-4a(2H)-ol, (4aR,SaR)-4-(isoquinolin.-5-ylamino)octahydronaphthalen-4a(2H)-ol, (4aR,8a)-4-(quinolin-5-.ylamino)ootahydronaphthalen-4a(2H)-ol, 20 (4aR,8aR)-4-(isoquinolin- I -yhamino)octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-(quinolin-2-ylamino)octahydronaphthalen-4a(2H)-ol, (4aRt8aR)-4- (quinolin-6-ylamino)octahydronaphthalen-4a(2H-)-ol, (4aR, 8aR)-4-(quinolin-3 -ylamino)octahydronaphthialen-4a(2H)-ol, (4aR,SaR)-4-(isoquinolin-3 -ylamino)oetahydro-naphthalen-4a(2fl)-ol, 25 (4aR,8aR)-4-(naphthalen-2-ylamino)octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-44(naphthalen- I -ylamino)octahydronaphthalen-4a(2H-o1, (4aR,SaR)-4-(biphenyl-2-ylamiino)octahydronaphthalen-4a(2H)-ol, (4aS8 aR)-4-(morpholin-4-yl)octahydronaphthalen-4a(21fy-ol, (4S, 4a8, 8aR)-4- ([241l H-indol-3 -yI)ethyl] amino) octahydronaphthalen-4a(2Hy-oI, 30 (4R,4a8, 8aR)-4-1{[241l H-indol-3 -yl)ethyl] amino)I octahydronaphthalen-4a(29V-ol1, (4S, 4aS8aR)-4-[(2-phenylethyl)arninojoctahydronaphthalen-4a(2H)-ol, (4R,4aS,8aR)-4- [(2-phenylethyl)aminojoctahydronaphthalen-4a(21)-o, (4R,4aS,8aR)-4-f(1I,3-benzodioxol-5-ylmethyl)amilno]octahydronaphthalen-4a(2H)-ol, (48,4aS,SaR)-4- [(1,3 -benz-odioxol-5-ylrneth-yl)amino] octahydronaphthalen-4a(2H)-ol, -91- WO 2011/043954 PCT/US2O1O/050493 (I R,4aR,XaS)-Sa-hydroxy-N-( 1 -phenylethyl)decahydronaphthialen- 1 -aminium, (1 S,4aR,8a5)-8a-hydroxy-N-( 1-phenylethyl)deoahydronaphthalen-l1-aminium, (1 R,4aR,Xa$)-N-benzyl-8a-hydroxydecabydronaphthalen-l1-aminium, (1 S,4aR,8aS)-N-benzyl-8a-hydroxydecahydronaphthalen-lI-aminium, 5 (4a8,SaR )-4-(3 ,4-dihydroisoquinolin-2( 1 -yl)octahydronaphthalen-4a(2H)-o1, (4aS,8aR>-4-(pyridin-3 -ylamino)octahydronaphthalen-4a(21i)-ol, (4R,4aS,8a)-4-( 1,3 -benzodioxol-5-ylamino)octahydronaphthalen-4a(2Th-ol, (48,4a8,8aR)-4-(1 ,3-benzodioxol-5-ylamino)octahydronaphthalen-4a(2H)-ol, (4R,4aS,8aR)-4-[(4-methylphenyl)amino] octahydronaphthalen-4a(2H)-ol, 10 (48,4a8aR)-4- [(4-methylphenyl)amnino]octahydronaphthalen-4a(2H)-ol, (4R,4aSr,8aR)-4-[(3 -chlorophenyl)aminioloctahydronaphthalen-4a(2Th-ol, (48,4aS,8aR)-4-II(3-chlorophenyl)amino]octahydronaphthalen-4a(2Th-ol, (4a8, 8a)-4- [(2-chlorophenyl)amino]octahydronaphthalen-4a(2H)-ol, (4R,4a8, 8aR)-4- [(4-methoxyphenyl)aminojoctahydronaphthalen-4a(21J)-ol, 15 (48,4aS,SaR)-4-[(4-methoxyphenyl)amino]octahydronaphthalen-4a(2H)-ol, (4R,4a8aR)-4- [(3-methoxyphenyl)amino] octahydronaphthalen-4a(2H)-ol, (4S,4aS,SaR)-4- [(3 -methoxyphenyl)aminojoctahydronaphthalen-4a(2H)-ol, (4R,4a8,8aR)-4- [(2-methoxyphenyl)amino] octahydronaphthaleni-4a(2H)-ol, (48,4a8aR)-4-[I(2-methoxyphenyl)amino] octahydronaphthalen-4a(2H)-ol, 20 4-f{ [(IR,4aR,8aS)-8a-hydroxydecahydronaphthaleni-1 -yljarnino }beuzonitrile, 4- {[(1 S,4aR,8a5)-8a-hydroxydecahydronaphthalen- 1-yljamino) benzonitrile, 3 -{[(I R,4aR,8a8)-Sa-hydroxydecahydronaphthalen- I1-yl] amino I benzonitWile, 3- {[(1 S,4aR, SaS)-8a-hydroxydecahydronaphthalen- 1-yljaanino }benzonitrile, (4R,4aS,SaR)-4-(phenytamino)octahydronaphthalen-4a(2H)-ol, 25 (48,4aS,SaR)-4-(phenylamino)octahydronaphthalen-4a(2H)-ol, (4aR,Sak)-4-(2,3 -dihydro- 1H-inclen-2-ylamino)octahydronaphthalen-4a(2HI)-ol, (4aR,SaR)-4-(2,3-dihydro-1H-inden- 1-ylamino)oetahydronaphthalen-4a(2H)-ol, (4aR,SaR)-4-j(2, 5-difluorophenyI)aminoloctahydronaphthalen-4a(2Hy-o, (4a-R,SaR)-44[(2-methylpropyl)amino]octahydronaphthalen-4a(2TH-o, 30 (4aR,SaR)-4-( 1 H-indol-5 -ylamino)octahydronaphthalen-4a(2Th-ol, (4aR,8a)-4-(pyridin-4-ylamino)octahydronaphthalen-4a(2H-ol, (48,4aR,8aR)-4-(tetrahydro-2H-pyran-4-ylamino)octahydronaphthalen-4a(2H)-ol, (4R,4aR,8aR)-4-(tetrahydro-2H-pyran-4-ylamino)octahydronaphthalen-4a(21)-ol, (4aRh8aR)-4-(cyclopentylamino)octahydronaphthalen-4a(2H)-ol, - 92 - WO 2011/043954 PCT/US2O1O/050493 (4aR,8aR)-4-( 1,2,3 ,4-tetrahydronaphthalen- 1 -ylamino)octahydronaphthalen-4a(2Tho1, (4aR,8aR)-4- { [(I S,2R)-2-.hydroxycyclohexyl] amino) octahydronaphthalen-4a(2TH-oI, (4aR,8aR)-4-[(pyrimidin-5-ylrnethyl)amino] octahydronaphthaie'n-4a(2N)-ol, (4aR,8aR)-4-(tetrahydro-2H-pyran-3 -ylamino)octahyclronaphthalen-4a(2H)-ol, 5 (4aR,SaR)-4-[(2,2,2-trifiuoroethyl)amino] octahydronaphthalen-4a(2Th-ol, (4aR,8aR)-4- [(2-methylcyclohexyl)amino] octahiydronaphthalen-4a(2H)-ol, (4aR,8aR)-4- [(2-methoxyethyl)amino] octahydronaphthalen-4a(2Th-ol, (4aR,,8aR)-4- [(38,58,75)-tricyclo [3.3.1 .13,7 2 ]dec- 1 -ylaniino] octahydro-naph-thalen-4a(2H)-ol, (4aR,8aR)-4-(2,3 -dihydro- 1H-inden-2-ylamino)octahydronaphthalen-4a(21f)-l, 10 (4aR,SaR)-4-(morpholin-4-.yl)octahydronaphthalen-4a(2H)-ol, (4aR,SaR)-4- { [2-( 1H-indol-3 -yl)ethyl jaminol}octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4- [(2-phenylethyl)arnino] octahyclronaphthalen-4a(2H)-ol, (4aR,8aR)-4[( 1,3 -benzodioxol-5-ylmethyl)amino] octahydronaphthalen-4a(2-H)-ol, (4aR,8aR)-4-4(l1-phenylethyl)amino] octahydronaphthalen-4a(2H)-ol, 15 (4aR,8aR)-4-(benzylamino)octahydronaphthalen-4a(2f)-ol, (4aR,8aR)-4-(3 ,4-dihydroisoquinolin-2(If)-yl)octahydronaphthalen-4a(2Hy-ol, (4aR,8aR)-4-{pyridin-3 -ylamino)octaliydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-( 1,3 -benzodioxol-5-ylantno)octahydronaphthalen-4a(2H)-ol, (4a.R,8aR)-4- [(4-methiylphenyl)aminojoctahydronaphthalen-4a(2Hy-ol, 20 (4aR,8aR)-4-[(3 -chlorophenyl)amino]octahydronaphthalen-4a(2H)-ol, (4aR,SaR)-4-[(3 -chlorophenyl)amino]octahydronaphthalen-4a(2H)-ol, (4aR,8aR)-4-[(4-methoxyphenyl)amino]octahydronaphthalen-4a(2H)-o1, (4aR,Sa)-4- [(3-methoxyphenyl)amino] octahydronaphthalen-4a(21t)-ol, (4aR,SaR)-4- [(2-methoxyphenyl)amino] octahydronaphthalen-4a(2I)-o1, 25 4- { [(4ak,8aR)-Sa-hydroxydecahydronaphthalen- I yl] amino)} benzonitrile, 3 -{ [(4aR,SaR)-Sa-hydroxydecahydronaphthalen- I -yI] amino)} benzonitrile, 2- { [(4aR,SaR)-Sa-h-ydroxydecahydronaphthalen- 1 -yl] amino I beuzonitrile, 4-(phenylainino)octahydronaphthalen-4a(2H)-ol, (4aR,5 S ,aR)-8-( 1,3 -dioxolan-2-yl)-5- [(4-fluorophenyl)amino]hexahydro-2H-chromen-4a(5H) 30 ol, (4a8 ,5R,8aR)-5- [(4-fluorophenyl)(methyl)aminolhexahydro-21-chromen-4a(51I)-ol, (4aS,5R,SaR)-5-[(3 ,4-difluorophenyl)amnino]hexahydro-2L1-chromen-4a(5H)-ol, (4aS ,5R,8aR)-5 -(phenylamiino)hexahydro-2J4-ehromen-4a(5H)-oI, (4aR,5 S,SaR)-5- [(4-fluorophenyl)Qnethyl)amino]hexahydro-2U-chromen-4a(5H)-ol, - 93 - WO 2011/043954 PCT/US2O1O/050493 (4aR,5 S,8aR)-5- [(3 ,4-difluorophenyl)amino]hexahydro-2H-cb-rornen-4a(5H)-oI, (4aR,5 8,8aR)-5 -(phenylamino)hexahydro-2fl-chromen-4a(5H)-ol, (4aR,SR,8aR)-8-(dimethoxyr-nethylj-5- [(4-fluorophenyl)amino]hexahydro-2H-cbromen-4a(51) ol, 5 (4a8 ,5R,8aS)-5-[(4-fluoropheniyl)amino]hexahydro-2l-chromen-4a(5H)-ol, (4aR,5 8,8a8)-5-[(4-fluorophenyl)amninolhexahydro-2H-chromen-4a($Ff)-ol, (4aR,5S,8aR)-N-(4-fluorophenyl)-4a-methoxy-8-(methoxymethyl)-N-methyloctahydro-2H cbromen-5-amine, (4aR,5 8, SaR)-5- [(4-fluorophenyl)(methyl)aminoj -8-(methoxymethyl)hexahydro-2U-chrornen 10 4a(SH)-oI, (4aR,5 S)-5- [(3 ,4-difluorophenyl)amino]-S-(methoxymefliyl)hexahydro-2H-chromen-4a(5H)-ol, (4aR,5 S)-4a-methoxy-8-(methoxymethyl)-N-phenyloctahydro-2H-ehromen-5-amine, (4aR,5 S)-8-(methoxymethyl)-5-(phenylamino)hexahydro-2H-chromen-4a(SH)-ol, (4aR,S S)-N-{4-fluorophenyl)-4a-rnethoxy-8-(methoxymethyl)octahydro-2H-chromen-5-amine, 15 (4aR,5 S)-5-[j4-fluoropheny1)(methy)aminoJ-8-(hydroxymethyI)hexahiydro-2H-chromen-4a(5H)c 01, (4aR,5S)-5- [(3 ,4-difluorophenyl)amino]-8-(hydroxymethy1)hexahydro-2H-chromen-4a(5H)-o, (4aR,5 S)-8-(hydroxymethyl)-5-{phenylamino)hexahydro-2H-chromen-4a(51)-ol, (4aR,5 S)-8-( I [teru-butyl(diphenyl)silyl] oxy} xethyl)-5- [(4-fluorophenyl)amino] -hexahydro-2H 20 chromen-4a(5H)-ol, (4aR,5 8)-S -[(4-fluorophenyl)amino] -8-(methoxymethyl)hexahydro-2H-chromen-4a(5Hf)-ol, (4aR,5 S)-8-(f { tert-butyl(diphenyl)silyljoxy} methyl)-5- [(4-fluorophenyl)amino] -hexahydro-2H chromen-4a(5H)-ol, (4aR,5 Sj-8-( {[tert-butyl(diphenyl)silyl] oxy} methyl)-5 -[(3 ,4-difluorophenyl)arnino] -hexahydro 25 2H-chiromen-4a(SH)-ol, (4aR,5S)-8-({ [tert-butyl(diphenyl)silyl]oxylmethyl)-5-(phenylamino)hexahydro-2H-chronen 4a(5H)-ol, (4aR,5 8)-S -[(4-fluorophen-yl)amino] -8-(hydroxymethyl)hexahydro-2H-chromen-4a(511)-ol, (4aR,5 8)-8-( {[tert-buty1(dipheny)sily1~oxy} methyl)-5-[R4-fluorophenyl)arnino] -hexahydro-2H 30 chromen-4a(511)-ol, (4R,4aR,SaR)-4- [(4-fluorophenyl)(methyl)amino] octahydro-4aHI-isoehrornen-4a-ol, (4aR,5R,8aS)-5-(phenylamino)octahydro-4aH-isochromen-4a-oI, (4aR,5R,8a8)-5- [(3 ,4-difluorophenyl)aminojoctahydro-4aH-isochromen-4a-ol, (4aR,5R,8a8)-5-[(4-fluorophenyl)amino] oetahydro-4aH-isochromen-4a-dl, -94- WO 2011/043954 PCT/US2010/050493 (4R,4aR,8aR)-4-[(3,4-difluorophenyl)amino]octahydro-4aH-isochromen-4a-ol, (4R,4aR,8aR)-4-(phenylamino)octahydro-4aH-isochromen-4a-ol, (4R,4aR,8aR)-4-[(4-fluorophenyl)amino]octahydro-4aH-isochromen-4a-ol, (4R,4aS,8aS)-4-[(4-fluorophenyl)(methyl)amino]hexahydro-2H-chromen-4a(5H)-ol, 5 (4R,4aS,8aS)-4-[(3,4-difluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-ol, (4R,4aS,8aS)-4-(phenylamino)hexahydro-2H-chromen-4a(5H)-ol, (4R,4aS,8aS)-4-[(4-fluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-ol, (4S,4aR,8aS)-4-(4-fluorobenzyl)hexahydro-2H-chromen-4a(5H)-ol, (4aS,8R,8aR)-8-[(4-fluorophenyl)amino]hexahydro-1H-isochromen-8a(3H)-ol, 10 (4aS,8R,8aR)-8-[(3,4-difluorophenyl)amino]hexahydro-HI -isochromen-8a(3H)-ol, (4aS,8S,8aS)-8-[(4-fluorophenyl)amino]hexahydro- 1 H-isochromen-8a(3H)-ol, (4aS,8S,8aS)-8-[(3,4-difluorophenyl)aminojhexahydro- 1 H-isochromen-8a(3H)-ol, benzyl ethyl({(4aR,5S,8S,8aR)-5-[(4-fluorophenyl)amino]-4a-hydroxyocta-hydro-2H-chromen-8 yl}methyl)carbamate, 15 (4aR,5S,8S,8aR)-8-[(ethylamino)methyl]-5-[(4-fluorophenyl)amino]-hexahydro-2H-chromen 4a(5H)-ol, (4aS,5R,8S,8aR)-8-[(diethylamino)methyl]-5-[(4-fluorophenyl)amino]-hexahydro-2H-chromen 4a(5H)-ol, N-ethyl-N-({(4aS,5R,8S,8aR)-5-[(4-fluorophenyl)amino]-4a-hydroxy-octahydro-2H1-chromen-8 20 yl}methyl)-2-methylpropanamide, 1 -ethyl- 1 -({(4aS,5R,8S,8aR)-5-[(4-fluorophenyl)amino] -4a-hydroxy-octahydro-2H-chromen-8 yl}methyl)-3,3-dimethylurea, (4aR,5S,8S,8aR)-8-[(benzyloxy)methyl]-5-[(4-fluorophenyl)amino]hexahydro -2H-chromen 4a(5H)-ol, 25 (4aR,5S,8S,8aR)-5-[(4-fluorophenyl)amino]-8-[(2-methoxyethoxy)methyl]-hexahydro-2H chromen-4a(5H)-ol, or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer, or prodrug of the compound or its salt. 30 [13] 13. The compound according to claim 12 which is (4aR,8aR)-4-[(4 fluorophenyl)amino]octahydronaphthalen-4a(2H)-ol, or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer or prodrug of the compound or its salt. - 95 - WO 2011/043954 PCT/US2010/050493 [14] 14. The compound according to claim 12 which is (4R,4aR,8aR)-4 (phenylamino)octahydronaphthalen-4a(2H)-ol, or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer or prodrug of the compound or its salt. [15] 15. The compound according to claim 12 which is (4aR,5S,8aS)-5-[(4 5 fluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-ol, or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer or prodrug of the compound or its salt. [16] 16. The compound according to claim 12 which is (4aR,5S)-5-[(4 fluorophenyl)amino]-8-(methoxymethyl)hexahydro-2H-chromen-4a(5H)-ol, or a 10 pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer or prodrug of the compound or its salt. [17] 17. The compound according to claim 12 which is (4aS,5R,8aS)-5-[(4 fluorophenyl)amino]hexahydro-2H-chromen-4a(5H)-ol, or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer or prodrug of the compound or its salt. 15 [18] 18. A pharmaceutical composition comprising a compound according to claim I and a pharmaceutically acceptable carrier. [19] 19. A method for treating or preventing a condition involving activation of 20 TRPA1 or for which reduced TRPAI activity can reduce the severity, comprising administering a compound of formula I or a pharmaceutically acceptable salt thereof, or a solvate, hydrate, stereoisomer, enantiomer or prodrug of the compound or its salt. [20] 20. The method according to claim 19 for treating, preventing or alleviating chronic or acute pain or sensitivity to touch in a mammalian patient in need thereof comprising 25 administering to said patient a therapeutically effective amount, or a prophylactically effective amount, of a compound of claim 1, or a pharmaceutically acceptable salt thereof or a solvate, hydrate, stereoisomer, enantiomer or prodrug of the compound or its salt. [21] 21. The method according to claim 20 wherein the pain is post surgical pain, cancer pain, neuropathic pain or tempormandibular pain. - 96 -
类似技术:
公开号 | 公开日 | 专利标题 EP2485737B1|2014-06-25|Novel trpa1 antagonists TWI504604B|2015-10-21|Heterocyclic compound and use thereof US7825126B2|2010-11-02|Purine derivatives as A3 and A1 adenosine receptor agonists WO2014143799A9|2014-12-24|Substituted xanthines and methods of use thereof JP6526275B2|2019-06-05|SHIP 1 Modulators and Related Methods JP2010506851A|2010-03-04|Bicyclic heteroaromatic compounds TW201406728A|2014-02-16|Substituted tricyclic compounds with activity towards EP1 receptors US20190330261A1|2019-10-31|Ligand for orphan nuclear receptor nur77 and uses thereof KR20210070308A|2021-06-14|antibacterial compound US20120309990A1|2012-12-06|Processes for the Purification of Lubiprostone KR20190103286A|2019-09-04|HDAC6 Selective Inhibitor, Method of Preparation and Application thereof TW201938166A|2019-10-01|Cap-dependent endonuclease inhibitors AU2017356911A1|2019-06-20|Tricyclic sulfones as ROR gamma modulators WO2015184405A1|2015-12-03|Aromatic compounds, compositions and uses thereof AU2018369091B2|2021-02-18|Heterocyclic compound and application thereof in medicine JP2022501445A|2022-01-06|Terpenoid derivatives and their uses JP5983714B2|2016-09-06|Crystal form of fluorine-containing amino acid prodrug and process for producing the same TW202100513A|2021-01-01|Crystal form of indole formamide derivatives substituted by deuterium atom and preparation method thereof EA028818B1|2018-01-31|Amide derivatives as lysophosphatidic acid receptor antagonists KR20210141461A|2021-11-23|Imidazoquinoline amine derivatives, pharmaceutical compositions, uses thereof WO2020154683A1|2020-07-30|Methods of treating disease with magl inhibitors CA3088000A1|2019-09-06|Saturated-ring-fused dihydropyrimidinone or dihydrotriazinone compounds and pharmaceutical use thereof CN113121417A|2021-07-16|Novel piperidine derivative and pharmaceutical application thereof EP2253636A1|2010-11-24|Neuronal cell death inhibitor
同族专利:
公开号 | 公开日 EP2485737B1|2014-06-25| EP2485737A4|2013-05-15| JP2013507364A|2013-03-04| US20120196894A1|2012-08-02| US8829196B2|2014-09-09| EP2485737A1|2012-08-15| WO2011043954A1|2011-04-14| CA2773713A1|2011-04-14|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题 US5369094A|1990-11-29|1994-11-29|The Administrators Of The Tulane Educational Fund|Polypeptide bombesin antagonists| US20030013733A1|2000-09-22|2003-01-16|Richard Apodaca|Octahydro-indolizine and quinolizine and hexahydro-pyrrolizine| TW200510373A|2003-07-14|2005-03-16|Neurogen Corp|Substituted quinolin-4-ylamine analogues| US20070196866A1|2004-03-13|2007-08-23|Irm Llc|Modulators of ion channel trpa1| GB0524808D0|2005-12-05|2006-01-11|Novartis Ag|Organic compounds| EP1962855B1|2005-12-22|2013-08-21|Hydra Biosciences, Inc.|Trpa1 inhibitors for treating pain| US20090023773A1|2007-06-27|2009-01-22|Painceptor Pharma Corporation|Compositions and methods for modulating gated ion channels|EP2520566A1|2011-05-06|2012-11-07|Orion Corporation|New Pharmaceutical Compounds| MX2014001551A|2011-08-09|2014-09-15|Hydra Biosciences Inc|Inhibiting transient receptor potential ion channel trpa1.| ME02745B|2012-10-01|2018-01-20|Orion Corp|N-prop-2-ynyl carboxamide derivatives and their use as trpa1 antagonists| US9394308B2|2013-01-18|2016-07-19|Merck Sharp & Dohme Corp.|Inhibiting the transient receptor potential A1 ion channel| US10603277B2|2013-06-20|2020-03-31|Glenmark Pharmaceuticals S.A.|Nanoparticulate formulation comprising a TRPA1 antagonist| CA2926389A1|2013-10-15|2015-04-23|Glenmark Pharmaceuticals S.A.|Pharmaceutical composition comprising a trpa1 antagonist and an analgesic agent| CN106061969B|2014-01-06|2019-10-29|阿尔戈么迪克斯有限公司|TRPA1 regulator| US20190175599A1|2014-09-16|2019-06-13|Glemark Pharmaceuticals S.A.|Trpa1 antagonist for the treatment of pain associated to diabetic neuropathic pain| WO2017060488A1|2015-10-09|2017-04-13|Almirall, S.A.|New trpa1 antagonists| WO2017064068A1|2015-10-14|2017-04-20|Almirall, S.A.|New trpa1 antagonists| WO2018109155A1|2016-12-16|2018-06-21|Galderma Research & Development|Trpa1 antagonists for use in the treatment of atopic dermatitis| WO2021233752A1|2020-05-19|2021-11-25|Bayer Aktiengesellschaft|Trpa1 antagonists for the treatment of diseases associated with pain and inflammation|
法律状态:
2015-04-23| MK4| Application lapsed section 142(2)(d) - no continuation fee paid for the application|
优先权:
[返回顶部]
申请号 | 申请日 | 专利标题 US24936009P| true| 2009-10-07|2009-10-07|| US61/249,360||2009-10-07|| PCT/US2010/050493|WO2011043954A1|2009-10-07|2010-09-28|Novel trpa1 antagonists| 相关专利
Sulfonates, polymers, resist compositions and patterning process
Washing machine
Washing machine
Device for fixture finishing and tension adjusting of membrane
Structure for Equipping Band in a Plane Cathode Ray Tube
Process for preparation of 7 alpha-carboxyl 9, 11-epoxy steroids and intermediates useful therein an
国家/地区
|