专利摘要:

公开号:AU2006235995A1
申请号:U2006235995
申请日:2006-11-10
公开日:2006-12-07
发明作者:Kari Alitalo;Markku Michael Jeltsch
申请人:Ludwig Institute for Cancer Research Ltd;Licentia Oy;
IPC主号:C12N15-62
专利说明:
AUSTRALIA
Patents Act 1990 COMPLETE SPECIFICATION STANDARD PATENT Applicants: LICENTIA LTD LUDWIG INSTITUTE FOR CANCER RESEARCH Invention Title: MATERIALS AND METHODS INVOLVING HYBRID VASCULAR ENDOTHELIAL GROWTH FACTOR DNAS AND PROTEINS AND SCREENING METHODS FOR MODULATORS The following statement is a full description of this invention, including the best method of performing it known to me/us: MATERIALS AND METHODS INVOLVING HYBRID Z VASCULAR ENDOTHELIAL GROWTH FACTOR DNAs AND PROTEINS The present application claims benefit of priority to U.S. Provisional Patent Application No. 60/205,331 filed May 18, 2000 and U.S. Provisional Patent it 5 Application No. 60/185,205 filed February 25, 2000. The entire text and drawing of Seach of the priority applications is specifically incorporated herein by reference, c without prejudice or disclaimer.
IN BACKGROUND OF THE INVENTION CThroughout this specification and the claims, unless the context requires 1 otherwise, the word "comprise" and its variations, such as "comprises" and "comprising," will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps.
The reference to any prior art in this specification is not, and should not be taken as an acknowledgement or any form of suggestion that such art forms part of the common general knowledge in Australia.
The PDGF proteins and their receptors (PDGFRs) are involved in regulation of cell proliferation, survival and migration of several cell types. The VEGF proteins and their receptors (VEGFRs) play important roles in both vasculogenesis, the development of the embryonic vasculature from early differentiating endothelial cells, and angiogenesis, the process of forming new blood vessels from pre-existing ones [Risau et al., Dev Biol 125:441-450 (1988); Zachary, Intl JBiochem Cell Bio 30:1169-1174 (1998); Neufeld et al., FASEB J13:9-22 (1999); Ferrara, JMolMed 77:527-543 (1999)]. Both processes depend on the tightly controlled endothelial cell proliferation, migration, differentiation, and survival. Dysfunction of the endothelial cell regulatory system is a key feature of cancer and several diseases associated with abnormal angiogenesis, such as proliferative retinopathies, age-related muscular degeneration, rheumatoid arthritis, and psoriasis. Understanding of the specific 3 biological function of the key players involved in regulating endothelial cells will lead to more effective therapeutic applications to treat such diseases [Zachary, Intl J Biochem Cell Bio 30:1169-1174 (1998); Neufeld et al., FASEB J 13:9-22 (1999); Ferrara, JMol Med 77:527-543 (1999)].
-2- ND The PDGF/VEGF Family The PDGF/VEGF family of growth factors includes at least the following Smembers: PDGF-A (see GenBank Ace No. X06374), PDGF-B (see e.g., S I GenBank Acc. No. M12783), VEGF (see GenBank Acc. No. Q16889 referred to C 5 herein for clarity as VEGF-A or by particular isoform), PIGF (see GenBank Acc.
No. X54936 placental growth factor), VEGF-B (see GenBank Acc. No. U48801; also known as VEGF-related factor VEGF-C (see GenBank Acc No.
O X94216; also known as VEGF related protein VEGF-D (also known as c-fosinduced growth factor (FIGF); see Genbank Acc. No. AJ000185), VEGF-E (also 0 known as NZ7 VEGF or OV NZ7 see GenBank Ace. No. 867522), NZ2 VEGF (also known as OV NZ2 see GenBank Acc. No. S67520), D1701 VEGF-like C protein (see GenBank Ace. No. AF106020; Meyer et al., EMBO J 18: 363-374), and NZ10 VEGF-like protein (described in International Patent Application PCT/US99/25869) [Stacker and Achen, Growth Factors 17: 1-11 (1999) Neufeld et al., FASEB J13 9-22 (1999) Ferrara, JMolMed 77: 527-543 (1999)].
Members of the PDGF/VEGF family are characterized by a number of structural motifs including a conserved PDGF motif defined by the sequence P-[PS]- C-V-X [GSTA]-G-C-C (SEQ ID NO: 1200). The brackets indicate that this Sposition within the polypeptide can be any one of the amino acids contained within the brackets. The number contained within the parentheses indicates the number of amino acids that separate the and residues. This conserved motif falls within a large domain of 70-150 amino acids defined in part by eight highly conserved cysteine residues that form inter-and intramolecular disulfide bonds. This domain forms a 2 cysteine knot motif composed of two disulfide bonds which form a covalently linked ring structure between two adjacent p strands, .and a third disulfide bond that penetrates the ring [see for example, Fig 1 in Muller et al., Structure 5: 1325-1338 (1997)], similar to that found in other cysteine knot growth factors, e. transforming growth factor-p (TGF-p). The amino acid sequence of all known PDGF/VEGF proteins, with 3 the exception of VEGF-E, contains the PDGF domain. The PDGF/VEGF family proteins are predominantly secreted glycoproteins that form either disulfide-linked or noncovalently bound homo-or heterodimers whose subunits are arranged in an antiparallel manner [Stacker and Achen, Growth Factors 17: 1-11 (1999); Muller et al., Structure 5 1325-1338 (1997)].
The PDGF subfamily The PDGFs regulate cell proliferation, cell survival and chemotaxis of many cell types in vitro (reviewed in [Heldin et al., Biochinica et Biophysica Acta 3
O
1378 F79-113 (1998)]. The two chains that make up PDGF, PDGF-A and PDGF-B, can homo-or heterodimerize producing three different isoforms PDGF-AA, PDGF z AB, or PDGF-BB. PDGF-A is only able to bind the PDGF a-receptor (PDGFR-a), Swhereas PDGF-B can bind both the PDGF-a and a second PDGF receptor (PDGF-p).
In vivo, the PDGF proteins exert their effects in a paracrine manner since they often are expressed in epithelial (PDGF-A) or endothelial (PDGF-B) cells in close apposition to the PDGF receptor-expressing mesenchyme (reviewed in Ataliotis et al., Int Rev Cytology 172 95-127 (1997)]. Overexpression of the PDGFs has been observed in several pathological conditions, including malignancies, atherosclerosis, and I 10 fibroproliferative diseases. In tumor cells and cell lines grown in vitro, coexpression of Sthe PDGFs and PDGF receptors generates autocrine loops, which are important for cellular transformation [Betsholtz et al., Cell 39 447-57 (1984) Keating et al., Science 239 914-6 (1988)].
The importance of the PDGFs as regulators of cell proliferation and cell survival is well illustrated by recent gene targeting studies in mice. Homozygous null mutations for either PDGF-A or PDGF-B are lethal in mice. Approximately 50 of the homozygous PDGF-A deficient mice have an early lethal phenotype, while the surviving animals have a complex postnatal phenotype with lung emphysema due to improper alveolar septum formation, and a dermal phenotype characterized by thin dermis, misshapen hair follicles, and thin hair. PDGF-A is also required for normal development of oligodendrocytes and subsequent myelination of the central nervous system. The PDGF-B deficient mice develop renal, hematological and cardiovascular abnormalities where the renal and cardiovascular defects, at least in part, are due to the lack of proper recruitment of mural cells (vascular smooth muscle cells, pericytes or mesangial cells) to blood vessels.
The VEGF subfamily The VEGF subfamily is composed of PDGF/VEGF members which share a VEGF homology domain (VHD) characterized by the sequence C-X (22-24)-P [PSR]- C-V-X [GSTA]-G-C-C-X (32-41)-C (SEQ ID NO: 1201). The VHD domain, determined through analysis of the VEGF subfamily members, comprises the PDGF 0 z motif but is more specific.
0 VEGF-A was originally purified from several sources on the basis of its mitogenic activity toward endothelial cells, and also by its ability to induce microvascular permeability, hence it is also called vascular permeability factor (VPF).
VEGF-A has subsequently been shown to induce a number of biological processes Sincluding the mobilization of intracellular calcium, the induction of plasminogen activator and plasminogen activator inhibitor-1 synthesis, promotion of monocyte migration in vitro, induction of antiapoptotic protein expression in human endothelial cells, induction of fenestrations in endothelial cells, promotion of cell adhesion molecule expression in endothelial cells and induction of nitric oxide mediated vasodilation and hypotension [Ferrara, JMol Med 77: 527-543 (1999); Neufeld et al., FASEBJ13: 9-22 (1999); Zachary, IntlJBiochem Cell Bio 30: 1169-1174 (1998)].
VEGF-A is a secreted, disulfide-linked homodimeric glycoprotein composed of 23 IcD subunits. Five human VEGF-A isoforms of 121, 145, 165, 189 or 206 amino acids in length (VEGF21- 206 encoded by distinct mRNA splice variants, have been described, all of which are capable of stimulating mitogenesis in endothelial cells. However, each isoform differs in biological activity, receptor specificity, and affinity for cell surface- and extracellular matrix-associated heparan-sulfate proteoglycans, which behave as low affinity receptors for VEGF-A. VEGF 21 does Snot bind to either heparin or heparan-sulfate; VEGF,4, and VEGF, 6 5 (GenBank Ace.
No. M32977) are both capable of binding to heparin; and VEGF 9 and VEGF 2 0 6 show the strongest affinity for heparin and heparan-sulfates. VEGF,2,, VEGF 45 and VEGF,,, are secreted in a soluble fonn ,although most ofVEGF,,, is confined to cell surface and extracellular matrix proteoglycans, whereas VEGF, 8 g and VEGF20 6 remain associated with extracellular matrix. Both VEGF,g and VEGF 2 06 can be released by treatment with heparin or heparinase, indicating that these isoforms are bound to extracellular matrix via proteoglycans. Cell-bound VEGF,, can also be cleaved by proteases such as plasmin, resulting in release of an active soluble VEGFoo. Most tissues that express VEGF are observed to express several VEGF isoforms simultaneously, although VEGF,, and VEGF, 6s are the predominant forms, whereas
ID
VEGF
2 0 6 is rarely detected [Ferrara, JMol Med 77:527-543 (1999)]. VEGF,45 differs O in that it is primarily expressed in cells derived from reproductive organs [Neufeld et al., FASEB J 13:9-22 (1999)].
The pattern of VEGF-A expression suggests its involvement in the development and maintenance of the normal vascular system, and in angiogenesis associated with tumor growth and other pathological conditions such as rheumatoid I arthritis. VEGF-A is expressed in embryonic tissues associated with the developing C vascular system, and is secreted by numerous tumor cell lines. Analysis of mice in which VEGF-A was knocked out by targeted gene disruption indicate that VEGF-A is C 10 critical for survival, and that the development of the cardiovascular system is highly sensitive to VEGF-A concentration gradients. Mice lacking a single copy of VEGF-A die between day 11 and 12 of gestation. These embryos show impaired growth and several developmental abnormalities including defects in the developing cardiovasculature. VEGF-A is also required post-natally for growth, organ development, regulation of growth plate morphogenesis and endochondral bone formation. The requirement for VEGF-A decreases with age, especially after the fourth postnatal week. In mature animals, VEGF-A is required primarily for active angiogenesis in processes such as wound healing and the development of the corpus luteum. [Neufeld et al., FASEB J 13:9-22 (1999); Ferrara, JMol Med 77:527-543 (1999)]. VEGF-A expression is influenced primarily by hypoxia and a number of hormones and cytokines including epidermal growth factor (EGF), TGF-f, and various interleukins. Regulation occurs transcriptionally and also posttranscriptionally such as by increased mRNA stability [Ferrara, JMol Med 77:527- 543 (1999)].
PIGF, a second member of the VEGF subfamily, is generally a poor stimulator of angiogenesis and endothelial cell proliferation in comparison to VEGF- A, and the in vivo role of PIGF is not well understood. Three isoforms of PIGF produced by alternative mRNA splicing have been described [Hauser et al., Growth Factors 9:259-268 (1993); Maglione et al., Oncogene 8:925-931 (1993)]. P1GF forms both disulfide-liked homodimers and heterodimers with VEGF-A. The P1GF- VEGF-A heterodimers are moie effective at inducing endothelial cell proliferation and angiogenesis than PIGF homodimers. PIGF is primarily expressed in the 0 z placenta, and is also co-expressed with VEGF-A during early embryogenesis in the 0 trophoblastic giant cells of the parietal yolk sac [Stacker and Achen, Growth Factors 17:1-11 (1999)].
VEGF-B, described in detail in International Patent Publication No. WO 96/26736 and U.S. Patents 5,840,693 and 5,607,918, shares approximately 44% amino acid identity with VEGF-A. Although the biological functions of VEGF-B in vivo remain incompletely understood, it has been shown to have angiogenic O properties, and may also be involved in cell adhesion and migration, and in regulating C" 10 the degradation of extracellular matrix. It is expressed as two isofonns of 167 and 186 amino acid residues generated by alternative splicing. VEGF-B,, is associated with the cell surface or extracellular matrix via a heparin-binding domain, whereas VEGF-B,,i is secreted. Both VEGF-B, 67 and VEGF-B, 6 can fonn disulfide-linked homodimers or heterodimers with VEGF-A. The association to the cell surface of
VEGF,,-VEGF-B,,
7 heterodimers appears to be determined by the VEGF-B component, suggesting that heterodimerization may be important for sequestering VEGF-A. VEGF-B is expressed primarily in embryonic and adult cardiac and skeletal muscle tissues [Joukov et al., J Cell Physiol 173:211-215 (1997); Stacker and Achen, Growth Factors 17:1-11 (1999)]. Mice lacking VEGF-B survive but have smaller hearts, dysfunctional coronary vasculature, and exhibit impaired recovery from cardiac ischemia [Bellomo et al., Circ Res 2000;E29-E35].
A fourth member of the VEGF subfamily, VEGF-C, comprises a VHD that is approximately 30% identical at the amino acid level to VEGF-A. VEGF-C is originally expressed as a larger precursor protein, prepro-VEGF-C, having extensive amino- and carboxy-tenninal peptide sequences flanking the VHD, with the Cterminal peptide containing tandemly repeated cysteine residues in a motif typical of Balbiani ring 3 protein. Prepro-VEGF-C undergoes extensive proteolytic maturation involving the successive cleavage of a signal peptide, the C-terminal pro-peptide, and the N-terminal pro-peptide. Secreted VEGF-C protein consists of a non-covalentlylinked homodimer, in which each monomer contains the VHD. The intermediate forms of VEGF-C produced by partial proteolytic processing show increasing affinity
ID
O
-7for the VEGFR-3 receptor, and the mature protein is also able to bind to the VEGFR- 0 2 receptor. [Joikov et al., EMBOJ., 16:(13):3898-3911 (1997).] It has also been demonstrated that a mutant VEGF-C, in which a single cysteine at position 156 is either substituted by another amino acid or deleted, loses the ability to bind VEGFR-2 but remains capable of binding and activating VEGFR-3 [hIternational Patent Publication No. WO 98/33917]. In mouse embryos, VEGF-C mRNA is expressed primarily in the allantois, jugular area, and the metanephros. [Joukov et al., J Cell Physiol 173:211-215 (1997)]. VEGF-C is involved in the regulation of lymphatic Sangiogenesis: when VEGF-C was overexpressed in the sin oftransgenic mice, a S 10 hyperplastic lymphatic vessel network was observed, suggesting that VEGF-C induces lymphatic growth [Jeltsch et al., Science, 276:1423-1425 (1997)]. Continued expression of VEGF-C in the adult also indicates a role in maintenance of differentiated lymphatic endothelium [Ferrara, JMolMed 77:527-543 (1999)].
VEGF-C also shows angiogenic properties: it can stimulate migration of bovine capillary endothelial (BCE) cells in collagen and promote growth of human endothelial cells [see, eg., International Patent Publication No. WO 98/33917, incorporated herein by reference].
VEGF-D is structurally and functionally most closely related to VEGF-C [see International Patent Publ. No. WO 98/07832, incorporated herein by reference]. Like VEGF-C, VEGF-D is initially expressed as a prepro-peptide that undergoes Nterminal and C-terminal proteolytic processing, and forms non-covalently linked dimers. VEGF-D stimulates mitogenic responses in endothelial cells in vitro. During embryogenesis, VEGF-D is expressed in a complex temporal and spatial pattern, and its expression persists in the heart, lung, and skeletal muscles in adults. Isolation of a biologically active fragment of VEGF-D designated VEGF-DANAC, is described in International Patent Publication No. WO 98/07832, incorporated herein by reference.
VEGF-DANACconsists of amino acid residues 93 to 201 of VEGF-D linked to the affinity tag peptide FLAG Four additional members of the VEGF subfamily have been identified in poxviruses, which infect humans, sheep and goats. The orf virus-encoded VEGF-E and NZ2 VEGF are potent mitogens and permeability enhancing factors. Both show approximately 25% amino acid identity to mnammalian VEGF-A, and are expressed as ZdisLffide-liked hornodlimers. Infection by Ilhese viruses is characterized by pLIstulr dermititis which may involve endothelial cell proliferation and vascular I)enneability induced by these viral VEGE proteins. [Ferrara, J~olMed 77:527-543 (1999); V) 5 Stacker and Achen, Growth Factor-s 17:1-11 1(1999)]. VEGF-]ike proteins have also been identified ffrm two additional strains Ofilt OFF viruLs, D 1701 [GenBarik Acc.
No. AF106020; described in Meyer et al:, EMBO JJ8:363-374 (1999)] and NZlO (described in International Patent Application PCT/US99/25 869, incorporated herein by reference]. These viral VEGF-like p~roteins have been shown to bind VEGFR-2 (i 10 present on host endothelium, and this binding is important for development of infection and viral induction of angiogeniesis [Meyer et al., EMBO J 18:363-374 (1999); International Patent Application PCTF/US99/25869].
PDGF/VEGF Recentors Seven cell surface receptors that interact with PDGF/VEGF family members have been identified. These include PDGFR-ax (see GenBank Ace. No.
NM06206) PDGFR-3 (see GenBank Ace. No. NM002609), VEGFR-1/Flt-l( fins-like tyrosine kinase-1; GenBank Ace. No. X51602; De Vries et Science 255:989-99 1 (1992)); VEGFR-2/K-DRIFlk-1 (kinase insert domain containing receptor/fetal liver kinase-1; GenBank Ace. Nos. X59397 (Flk-1) and L04947 (KDR); Terman et BiochemnBiophys Res Comm 187:1579-1586 (1992); Matthews et a., Proc Nat! Acad Sci USA 88:9026-9030 (1991)); VEGFR-3/Flt4 (fins-like tyrosine kinase 4; U.S. Patent No. 5,776,755 and Genl~ank Ace. No. X68203 and S66407; Pajusola et al., Oncogene 9:3545-3555 (1994)), neuropilin-1 (Gen Bank Ace. No.
NM003873), and neuropilin-2 (Gen Bank Ace. No. NM003872). The two PDGF rcposmediate signaling of PDGFs as described above. VBGF 2VEGF65 VEGF-B, PlGF-1 and PIGF-2 bind VEGF-RJ; VEGF,, VEGF 1 45
VEGF
16
VEGF-
C, VEGF-D, VEGF-E, and NZ2 VEGF bind VEGF-R2; VEGF-C and VEGF-D bind VEGFR-3; VEGF 165 PIGF-2, and NZ2 VFGF bind neuropilin-1; anid VEGF 6 5 binds neuropilin-2. Neufeld et al., FASEBJI13:9-22 (1999); Stacker and Achen, Growth Factors 17:1-11 (1999); Ortega et al,, Fron Biosci 4: 141-152 (1999); Zachary, Intl J
IND
8 -9- Biochem Cell Bio 30:1169-1174 (1998); Petrova et al., Exp Cell Res 253:117-130 O (1999)].
The PDGF receptors are protein tyrosine kinase receptors (PTKs) that contain five immunoglobulin-like loops in their extracellular domains. VEGFR-1, VEGFR-2, and VEGFR-3 comprise a subgroup of the PDGF subfamily of PTKs, distinguished by the presence of seven Ig domains in their extracellular domain and a split kinase domain in the cytoplasmic region. Both neuropilin-1 and neuropilin-2 are non-PTK C, VEGF receptors. NP-I has an extracellular portion includes a MAM domain; regions Sof homology to coagulation factors V and VIII, MFGPs and the DDR tyrosine kinase; and two CUB-like domains.
Several of the VEGF receptors are expressed as more than one isoform. A soluble isoform of VEGFR-1 lacking the seventh Ig-like loop, transmembrane domain, and the cytoplasmic region is expressed in human umbilical vein endothelial cells. This VEGFR-1 isofonr binds VEGF-A with high affinity and is capable of preventing VEGF-A-induced mitogenic responses [Ferrara, JMol Med 77:527-543 (1999); Zachary, Intl J Biochem Cell Bio 30:1169-1174 (1998)]. A C-terminal truncated from of VEGFR-2 has also been reported [Zachary, Intl JBiochem Cell Bio 30:1169-1174 (1998)]. In humans, there are two isoforms of the VEGFR-3 protein which differ in the length of their C-terminal ends. Studies suggest that the longer isofonn is responsible for most of the biological properties of VEGFR-3.
The receptors for the PDGFs, PDGF a-receptor (PDGFR-c) and the p-receptor (PDGFR-P), are expressed by many in vitro grown cell lines, and they are mainly expressed by mesenchymal cells in vivo (reviewed in [Raines et al., Peptide growth factors and their receptors, Heidelberg, Springer-Verlag (1990)]. As mentioned above, PDGF-B binds both PDGFRs, while PDGF-A selectively binds PDGFR-a.
Gene targeting studies in mice have revealed distinct physiological roles for the PDGF receptors despite the overlapping ligand specificities of the PDGFRs [Rosenkranz et al., Growth Factors 16:201-16 (1999)]. Homozygous null mutations for either of the two PDGF receptors are lethal. PDGFR-a deficient mice die during embryogenesis at el0, and show incomplete cephalic closure, impaired neural crest development, cardiovascular defects, skeletal defects, and odemas. The PDGFR-P deficient mice develop similar phenotypes to animals deficient in PDGF-B, that are 0 Z characterized by renal, hematological and cardiovascular abnormalities; where the 0 renal and cardiovascular defects, at least in part, are due to the lack of proper recruitment of mural cells (vascular smooth muscle cells, pericytes or mesangial cells) It 5 to blood vessels.
The expression of VEGFR-1 occurs mainly in vascular endothelial cells, Mc, although some may be present on monocytes, trophoblast cells, and renal mesangial N cells [Neufeld et al., FASEB J13:9-22 (1999)]. High levels of VEGFR-1 mRNA are also detected in adult organs, suggesting that VEGFR-1 has a function in quiescent endothelium of mature vessels not related to cell growth. VEGFR-1-/- mice die in utero between day 8.5 and 9.5. Although endothelial cells developed in these animals, the formation of functional blood vessels was severely impaired, suggesting that VEGFR-1 may be involved in cell-cell or cell-matrix interactions associated with cell migration. Recently, it has been demonstrated that mice expressing a mutated VEGFR-1 in which only the tyrosine kinase domain was missing show nonnal angiogenesis and survival, suggesting that the signaling capability of VEGFR-1 is not essential. [Neufeld et al., FASEB J13:9-22 (1999); Fenrara, JMol Med 77:527-543 (1999)].
VEGFR-2 expression is similar to that of VEGFR-1 in that it is broadly expressed in the vascular endothelium, but it is also present in hematopoietic stem cells, megakaryocytes, and retinal progenitor cells [Neufeld et al., FASEB J13:9-22 (1999)]. Although the expression pattern of VEGFR-1 and VEGFR-2 overlap extensively, evidence suggests that, in most cell types, VEGFR-2 is the major receptor through which most of the VEGFs exert their biological activities. Examination of mouse embryos deficient in VEGFR-2 further indicate that this receptor is required for both endothelial cell differentiation and the development ofhematopoietic cells [Joukov et al., J Cell Physiol 173:211-215 (1997)].
VEGFR-3 is expressed broadly in endothelial cells during early embryogenesis. During later stages of development, the expression of VEGFR-3 becomes restricted to developing lymphatic vessels [Kaipainen, et al., Proc. Natl.
Acad. Sci. USA, 92: 3566-3570 (1995)]. In adults, the lymphatic endothelia and some
ID
-11- Shigh endothelial venules express VEGFR-3, and increased expression occurs in O lymphatic sinuses in metastatic lymph nodes and in lymphangioma. VEGFR-3 is also expressed in a subset of CD34' hematopoietic cells which may mediate the myelopoietic activity of VEGF-C demonstrated by overexpression studies [WO 98/33917]. Targeted disruption of the VEGFR-3 gene in mouse embryos leads to failure of the remodeling of the primary vascular network, and death aller embryonic day 9.5 [Dumont et al., Science, 282: 946-949 (1998)]. These studies suggest an CN essential role for VEGFR-3 in the development of the embryonic vasculature, and also
ID
0during lymphangiogenesis.
c 10 Structural analyses of the VEGF receptors indicatethat the VEGF-A binding site on VEGFR-1 and VEGFR-2 is located in the second and third Ig-like loops.
Similarly, the VEGF-C and VEGF-D binding sites on VEGFR-2 and VEGFR-3 are also contained within the second Ig-loop [Taipale et al., Curr Top Microbiol hmmunol 237:85-96 (1999)]. The second Ig-like loop also confers ligand specificity as shown by domain swapping experiments [Ferrara, JMol Med 77:527-543 (1999)]. Receptorligand studies indicate that dimers forned by the VEGF family proteins are capable of binding two VEGF receptor molecules, thereby dimerizing VEGF receptors. The fourth Ig-like loop on VEGFR-1, and also possibly on VEGFR-2, acts as the receptor dimerization domain that links two receptor molecules upon binding of the receptors to a ligand dimer [Ferrara, JMol Med 77:527-543 (1999)]. Although the regions of VEGF-A that bind VEGFR-I and VEGFR-2 overlap to a large extent, studies have revealed two separate domains within VEGF-A that interact with either VEGFR- or VEGFR-2, as well as specific amino acid residues within these domains that are critical for ligand-receptor interactions. Mutations within either VEGF receptorspecific domain that specifically prevent binding to one particular VEGF receptor have also been recovered [Neufeld et al., FASEB J13:9-22 (1999)].
VEGFR-1 and VEGFR-2 are structurally similar, share common ligands
(VEGF,
2 and VEGF, 6 5 and exhibit similar expression patterns during development.
However, the signals mediated through VEGFR-1 and VEGFR-2 by the same ligand appear to be slightly different. VEGFR-2 has been shown to undergo autophosphorylation in response to VEGF-A, but phosphorylation of VEGFR-1 under
IO
O -12identical conditions was barely detectable. VEGFR-2 mediated signals cause striking Z changes in the morphology, actin reorganization, and membrane ruffling of porcine O aorlic enclothelial cells recombinantly overexpressing this receptor. In these cells, VEGFR-2 also mediated ligand-induced chemotaxis and mitogenicity; whereas I' 5 VEGFR-l-transfected cells lacked mitogenic responses to VEGF-A. Mutations in VEGF-A that disrupt binding to VEGFR-2 fail to induce proliferation of endothelial e¢ cells, whereas VEGF-A mutants that are deficient in binding VEGFR-1 are still k capable of promoting endothelial proliferation. Similarly, VEGF stimulation of cells expressing only VEGFR-2 leads to a mitogenic response whereas comparable stimulation of cells expressing only VEGFR-1 also results in cell migration, but does not induce cell proliferation. In addition, phosphoproteins co-precipitating with VEGFR-1 and VEGFR-2 are distinct, suggesting that different signaling molecules interact with receptor-specific intracellular sequences.
The emerging hypothesis is that the primary function of VEGFR-1 in angiogenesis may be to negatively regulate the activity of VEGF-A by binding it and thus preventing its interaction with VEGFR-2, whereas VEGFR-2 is thought to be the Smain transducer of VEGF-A signals in endothelial cells. In support of this hypothesis, mice deficient in VEGFR-1 die as embryos while mice expressing a VEGFR-1 receptor capable of binding VEGF-A but lacking the tyrosine kinase domain survive and do not exhibit abnormal embryonic development or angiogenesis. In addition, analyses of VEGF-A mutants that bind only VEGFR-2 show that they retain the ability to induce mitogenic responses in endothelial cells. However, VEGF-mediated migration of monocytes is dependent on VEGFR-1, indicating that signaling through this receptor is important for at least one biological function. In addition, the ability of VEGF-A to prevent the maturation of dendritic cells is also associated with VEGFR-1 signaling, suggesting that VEGFR-1 may function in cell types other than endothelial cells. [Ferrara, JMol Med 77:527-543 (1999); Zachary, Jntl JBiochem CellBio 30:1169-1174 (1998)].
Neuropilin-1 was originally cloned as a receptor for the collapsin/semaphorin family of proteins involved in axon guidance [Stacker and Achen, Growth Factors 17:1-11 (1999)]. It is expressed in both endothelia and specific subsets of neurons
ID
-13-
O
during embryogenesis, and it thought to be involved in coordinating the developing O neuronal and vascular system. Although activation of ncuropilin-1 does not appear to elicit biological responses in the absence of the VEGF family lyiosine-kinase receptors, their presence on cells leads to more efficient binding of VEGF,, 6 and VEGFR-2 mediated responses. [Neufeld et al., FASEBJ 13:9-22 (1999)1 Mice lacking neuropilin- show abnormalities in the developing embryonic cardiovascular nsystem. [Neufeld et al., FASEB J 13:9-22 (1999)] C Neuropilin-2 was identified by expression cloning and is a
ID
collapsin/semaphorin receptor closely related to neuropilin-1. Neuropilin-2 is an C 10 isoform-specific VEGF receptor in that it only binds VEGF, 6 5 Like neuropilin-1, neuropilin-2 is expressed in both endothelia and specific neurons, and is not predicted to function independently due to its relatively short intracellular domain. The function of neuropilin-2 in vascular development is unknown [Neufeld et al., FASEB J13:9-22 (1999); WO 99/30157].
Therapeutic applications for VEGF polvpeptides and antagonists The discovery of VEGF-A as a key regulator of vascular development has spurred active research using VEGF-based therapeutic angiogenesis in cardiovascular medicine, as well as for treating diseases characterized by pathological angiogenesis with VEGF antagonists. Subsequent identification of additional VEGF family proteins and their roles in vascularization have also led to the development of therapies based on these growth factors [Ferrara and Alitalo, Nature Med 5:1359-1364 (1999)]. Animal studies ofhindlimb ischemia, and myocardial ischemia using VEGF- A or VEGF-C, delivered by administration of recombinant protein or gene transfer using naked DNA or adenoviral vectors, implicate these molecules in promoting vascularization and increasing coronary blood flow. These promising results have led to clinical trials in which patients with limb ischemia were treated by arterial or intramuscular gene transfer of naked DNA encoding VEGF,, 5 Patients with myocardial ischemia or Burger's disease (thromboangiitis obliterans) were also injected locally with VEGF, 6 5 plasmid DNA. Although these trials were not placebocontrolled, the patients showed clinical improvement and evidence of angiogenesis in ischemic tissues. Trials using gene transfer of VEGF-C naked DNA or gene therapy 0 z with VEGF,, using adenoviral vectors to treat patients with myocardial ischemia are O currently in Phase I [Ferrara, Mol Med 77:527-543 (1999); Nenfeld et nl., FASEB J 13:9-22 (1999); Ferrara and Alitalo, Nature Med 5:1359-1364 (1999)]. The therapeutic effects of administering recombinant VEGF-A protein are also being tested in ongoing clinical trials. Results from a Phase 1 study of patients with f coronary ischemia treated with intracoronary infusion of recombinant VEGF,,, show evidence of improved perfusion and collateralization. However, in the subsequent Phase I study, the patients did not show significant improvement over the placebocontrolled group. Other potential therapeutic uses for.VEGF growth factors include using VEGF-C to promote lymphangiogenesis in patients whose axillary lymph nodes were removed during breast carcinoma surgery. Therapies using combinations of growth factors to promote vascularization in tissues may also prove to be preferable in treating certain diseases [Ferrara and Alitalo, Nature Med 5:1359-1364 (1999)].
Therapies based on inhibiting the activity of VEGF growth factors are being tested to treat disease states characterized by pathological angiogenesis. VEGF expression is upregulated in most human tunors including primary breast cancer and gastric carcinoma. Studies in mice indicate that tumor-associated angiogenesis and growth of the tumor cells can be inhibited by treating the animals with monoclonal antibodies against VEGF-A. Further animal studies showed'that expression of a dominant negative VEGFR-2 mutant that prevents signaling through this receptor, or administration of recombinant VEGFR-1 or VEGFR-2 mutants, which only contain the extracellular portion of these receptors, suppresses growth of several tumor cell lines. These encouraging results led to clinical trials using humanized high affinity monoclonal antibodies against VEGF-A (rhuMAb VEGF) as VEGF-A inhibitors.
Phase II studies using rhuMAb VEGF to treat non-small cell lung carcinoma, colorectal carcinoma, breast, and renal cell carcinoma are currently ongoing.
Compounds targeting inhibition of VEGF-C activity are also being tested for therapeutic uses in cancer patients: small molecule inhibitors of VEGF-C are in Phase I trials, and monoclonal antibodies against VEGF-C are entering clinical trials.
Retinopathy associated with diabetes mellitus, occlusion of central retinal vein
O
Sor prematurity has been con-elated with increased levels of VEGF-A. Animal studies using monoclonal antibodies against VEGF-A or soluble VEGFR-I or VEGFR-2 mutants containing only the extracellular domain fised to immun.noglobulin yFe domain show suppression of retinal angiogenesis. VEGF-A is also detected in agerelated macular degeneration (AMD), and its expression is thought to be the cause of t neovascularization in this disease. Intravitreal delivery of recombinant humanized anti-VEGF-A Fab antibody fragment or injection of 2'-fluoropyrimidine RNA 0 oligonucleotide ligands (aptamers) to treat AMD are currently in clinical trials.
C l 10 Compounds that inhibit the activity of VEGF growth factors may also be used to treat other disease states involving abnormal angiogenesis. These include ischemicreperfusion related brain edema and injury, conditions associated with ovarian hyperplasia and hypervascularity such as the polycystic ovary syndrome, endometriosis, and ovarian hyperstinulation syndrome [Ferrara and Alitalo, Nature Med 5:1359-1364 (1999)].
From the foregoing discussion, it will be apparent that the VEGF family of growth factors, and inhibitors thereof, have tremendous potential as therapeutics. For example, such growth factors and inhibitors are useful to promote or inhibit angiogenesis where needed, such as in the treatment of ischemic disorders, the promotion of wound healing, or the inhibition or elimination of neoplastic disorders that are angiogenesis-dependent. However, the various naturally-occurring members of this growth factor family often bind multiple receptors, and the various known receptors are expressed on multiple cell types and have expression patterns that may vary depending on stage of development and the presence or absence of pathological conditions. The biological effects of any particular growth factor may be receptordependent, isoform dependent, and cell-type dependent. A desirable therapeutic effect mediated through one receptor may be accompanied by undesirable side-effects mediated through another receptor. Alternatively, a desirable therapeutic effect might be enhanced through stimulation of multiple receptors that cannot be stimulated with any single known growth factor that occurs in nature. Therefore, a need exists for novel peptide growth factors with their own unique profile of receptor binding and Z receptor-stimulating or receptor-inhibiting activities.
O
n 5 SUMMARY OF THE INVENTION The present invention satisfies needs identified above by providing novel polypeptide binding molecules for naturally occurring vascular endothelial growth k factor receptors, and polynucleotides that encode the novel polypeptides and are useful for recombinant expression of the polypeptides. For the purpose of describing the invention, the term "vascular endothelial growth factor" and the abbreviation "VEGF" (without modifier) are used herein in a generic sense, to describe any of a family of growth factor polypeptides including but not limited to Vascular Endothelial Growth Factor-A (VEGF-A), Vascular Endothelial Growth Factor-B (VEGF-B), Vascular Endothelial Growth Factor-C (VEGF-C), Vascular Endothelial Growth Factor-D (VEGF-D), Platelet Derived Growth Factor-A (PDGF-A), Platelet Derived Growth Factor-B (PDGF-B), Placenta Growth Factor (PIGF), and virally encoded VEGF-like molecules. VEGF-A is commonly referred to in the art as "Vascular Endothelial Growth Factor" or as "VEGF," but for clarity shall be referred to herein as VEGF-A or referred to as specific isoforms VEGF 6 5 of VEGF-A.
For example, in one aspect, the invention provides a chimeric polypeptide comprising a plurality of peptide subunits derived from two or more naturally-occurring vertebrate vascular endothelial growth factor polypeptides that have different vascular endothelial growth factor receptor binding profiles, wherein the chimeric polypeptide binds at least one receptor of one of the naturally-occurring vascular endothelial growth factor polypeptides, and wherein the chimeric polypeptide has a different receptor binding profile than the naturally-occurring growth factor polypeptides. Isolated and purified chimeric polypeptides are preferred.
In this context, the term "naturally-occurring vertebrate vascular endothelial growth factor polypeptides" means polypeptides having the following characteristics: the polypeptide is encoded by genomic DNA of a vertebrate a reptile, amphibian, bird, or mammal, preferably a bird or mammal, most preferably a IN 17 N mammal especially a primate mammal such as a monkey, ape, or human) or is encoded by the genome of a vertebrate pathogen such as mammalian pox viruses; S(2) the polypeptide comprises all or a portion of an amino acid sequence that is O expressed by a vertebrate from transcription/translation of the vertebrate's genomic DNA or from virally-induced transcription/translation, in the case of polypeptides encoded by viral nucleic acids); the polypeptide or portion comprises a VEGF/PDGF homology domain (V/PHD) of about 70-150 amino acids that binds to naturally-occurring receptors and Sthat is characterized in part by the amino acid motif: C-X (18-28)-P-X-C-X (4)-R-C-X S 10 G-C (6-12)-C-X (30-46)-C (SEQ ID NO: 1202), where X represents any amino Sacid and numbers in parentheses represent a permissible range of amino acids X (18-28) represents a stretch of any 18-28 amino acids C represents one or two cysteine residues). The V/PHD usually includes eight conserved cysteines which form a cysteine knot motif similar to that found in human Vascular Endothelial Growth Factors A, B, C, and D (VEGF-A,-B,-C, and-D), and human platelet-derived growth factors (PDGFs). Preferred polypeptides or portions comprise a V/PHD that is characterized by the more particular amino acid motif C-X (22-24)-P- [PSR]-C-V-X (32-41)-C (SEQ ID NO: 1203), where amino acids in brackets [PSR]) represent alternatives for a single position in the amino acid sequence; and the polypeptide binds to at least one cell surface receptor that is expressed on endothelial cells that line vertebrate blood or lymphatic vessels or pericytes/smooth muscle cells that line and support blood vessels. Preferred polypeptides bind to a least one cell surface receptor that is expressed on endothelial cells.
Thus, the term "naturally-occurring vertebrate VEGF polypeptides" means polypeptides that have certain specified structural and functional properties. The term is not intended in this context to imply a source of origin. Thus, recombinantly produced polypeptides that satisfy the above criteria because they have an amino acid sequences and receptor binding properties of VEGF polypeptides that exist in nature are considered "naturally-occurring". Numerous exemplary naturally occurring vascular endothelial growth factor polypeptides are already known in the art, including but not limited to human Vascular Endothelial Growth Factor-A (VEGF-A),
IO
S-18- Vascular Endothelial Growth Factor-B (VEGF-B), Vascular Endothelial Growth 0 Z Factor-C (VEGF-C), Vascular Endothelial Growth Factor-D (VEGF-D), Platelet 0 Derived Growth Factor-A (PDGF-A), Platelel Derived Growth Factor-B (PDGF-B), Placenta Growth Factor (PIGF); mammalian and avian orthologs thereof (where the S 5 term "ortholog" means species homolog); and Vascular Endothelial Growth Factor E (VEGF-E), NZ2 VEGF, and the two VEGF-like proteins identified in strains D1701 and NZ10, which have been identified in poxviruses. The use of naturally occurring IO human VEGF's is preferred for the purposes of developing chimeric molecules that are useful as human therapeutics, in order to minimize the likelihood of developing chimerics that generate an inunune response in humans. However, in many cases there is very high homology between VEGF species orthologs, especially in receptor binding domains, and it is contemplated that non-human naturally occurring VEGFs also can be used to generate chimeric molecules for use in treating humans. Although the invention is described herein in part with reference to particular VEGF-A/VEGF- C chimeric polypeptides, chimeric polypeptides derived from any pair, or three, or four, or more of the VEGFs described herein or their species orthologs is particularly contemplated.
As used to describe this aspect of the invention, the term "chimeric requires that the amino acid sequence of the chimeric molecule include at least one stretch of one or more amino acids (preferably stretches of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids) from each of the naturally-occurring VEGF's from which it was derived. Thus, the chimeric polypeptide is a "hybrid"or "mosaic" of two or more polypeptides. By "chimeric" is meant that the polypeptide of the invention is not identical to any naturally occurring VEGF sequence (or fragment of a natural VEGF sequence).
As used to describe this aspect of the invention, the term "derived from" (as in "derived from two or more naturally occurring VEGF polypeptides") means that, when the amino acid sequences of the chimeric polypeptide and the two or more naturally occurring VEGF's are aligned using a standard algorithm, substantially all of the amino acids in the chimeric polypeptide are aligned with an identical residue in one or more of the naturally occurring VEGF's from which the chimeric was derived.
ID
O -19- Standard protein alignment algorithms, for example, the clustral method (Nucl Acids 0 Res 22:4673-80 (1994)], the Jotun-Hcin method [Methds Enzymol 183:626-645 (1990)], or the Feng-Doolittle method [./Mol Evol 25:351-360 (1987)], can be used to align naturally-occurring vertebrate vascular endothelial growth factor polypeptides, such alignments being greatly facilitated by the presence of the eight highly conserved cysteines dispersed through the V/PHD. Thus, it is readily established that a chimeric t) polypeptide is "derived from" two or more naturally occurring VEGF's by performing CN an alignment using any generally accepted protein alignment algorithm. If, after 0 aligning the amino acid sequences of a chimeric polypeptide and two or more C 10 naturally occurring VEGF's using any standard algorithm, substantially all of the amino acids in the chimeric polypeptide are aligned with an identical residue in one or more of the naturally occurring VEGF's, then the chimeric polypeptide was derived from the naturally occurring VEGFs. In one embodiment, all of the amino acids of the chimeric molecule will align in this maumer. However, the use of the term "substantially all" reflects the fact that techniques described herein for making chimeric polypeptides will sometimes introduce mutations such as insertions, deletions, or substitutions, preventing 100% correlation to parent sequences. In such cases, at least about 90%, 92%, 94%, 95%. 96%, 97%, 98%, or 99% of the residues of the chimeric polypeptide will align with identical residues from at least one of the natural VEGF's.
When presented with a chimeric polypeptide of the invention that aligns perfectly or substantially with the natural VEGF polypeptides from which it was derived, it is within the skill of the art to intentionally introduce mutations (especially conserved mutations) into the chimeric polypeptide and test such a modified chimeric polypeptide for its receptor binding profile. Modifications of chimeric polypeptides (especially conserved amino acid substitutions) that do not introduce substantial changes in receptor binding profile are intended as equivalents within the scope of the present invention.
In the context of such chimeric polypeptides, the tern "plurality of peptide subunits" means two or more peptide subunits. Exemplified herein are chimeric polypeptides obtained by fragmenting two naturally occurring VEGF cDNA's (human
IO
VEGF-A and human VEGF-C) into nine subunits of about 8-16 codons each,
O
Z recombining these fragments into all 512 permutations of the nine subunits O (maitntaining submnit order), and expressing Ihe resultant chimeric cDNAs. The number and the size of fragments is not intended as a critical feature. In preferred lt 5 embodiments, plurality comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 or more subunits. As exemplified herein, the 3 "subunits" are joined by peptide bonds to form a polypeptide chain.
In the context of chimeric polypeptides of the invention or naturally occurring VEGF polypeptides, determination of "vascular endothelial growth factor receptor binding profile" means the determination of the receptors to which a polypeptide will bind and the receptors to which it will not. Known VEGF receptors, including VEGFR-1, VEGFR-2, and VEGFR-3, are described in greater detail elsewhere herein.
Known PDGF receptors are also described in greater detail elsewhere herein. Where a chimeric polypeptide has been derived in part from a naturally occurring PDGF sequence, screening the chimeric polypeptide for binding to PDGF receptors is contemplated as part of the receptor binding profile determination.) By way of example, if a chimeric polypeptide was derived from a VEGF-A that binds to VEGFR-1 and VEGFR-2 and from a VEGF-C that binds to VEGFR-2 and VEGFR-3, the chimeric polypeptide has a different receptor binding profile than either of its parent molecules if it binds to only one of the three receptors, or if it binds to all three receptors, or if it binds to VEGFR-1 and VEGFR-3 but not VEGFR-2. In one preferred embodiment, the invention provides chimeric polypeptides wherein the chimeric polypeptide binds to at least two VEGF receptors bound by the two or more naturally occurring vertebrate VEGF polypeptides, and wherein each of the naturally-occurring VEGF polypeptides from which the chimeric polypeptide was derived fail to bind to one or more of the at least two VEGF polypeptides.
Screening polypeptides of the invention for binding to the neuropilins NP-1 and NP-2 are not contemplated as part of the receptor binding profile determination, because the portions of VEGF (and other family members) responsible for NP-I and NP-2 binding are portions outside of the V/PHD core region. NP-1 binding is mediated by amino acid residues 142 to 185 of SEQ ID NO: 2 for VEGF-A, and
IO
-21amino acid residues 138 to 182 for VEGF-B [Soker et al., JBiol Chem 271:5761-7 S(1996); Makinen et al., JBiol Chem 274:21217-22 (1999)]. As explained below, addition of upstream or downstream sequences to chimeric polypeptides of the invention is contemplated, and some added sequences are contemplated to result in NP-1 or NP-2 binding.
The present invention is believed to provide the first disclosure of a t polypeptide that is capable of binding to all of VEGFR-1, VEGFR-2, and VEGFR-3.
CK All polypeptides having this receptor binding profile are intended as within the scope Sof the invention.
C 10 Naturally occurring VEGF polypeptides generally bind their respective receptors with high affinity, which is generally understood in this context to mean binding with a sub-nanomolar dissociation constant. For example, VEGF-A binds VEGFR-1 and VEGFR-2 with Kd of approximately 16 pM and 760 pM, respectively; and VEGF-C binds VEGFR-2 and VEGFR-3 with Kd of approximately 410 pM and 135 pM, respectively. Because it is possible to administer a therapeutic growth factor protein to achieve concentrations exceeding normal serum concentrations, and to formulate such polypeptides to increase biological half-life, it is contemplated that chimeric polypeptides having less receptor affinity higher dissociation constants) nonetheless will be useful as receptor agonists and antagonists. For the purposes of scoring receptor binding of chimeric polypeptides, a 50 nanomolar dissociation constant cutoff is selected. Chimeric polypeptides that bind a receptor with a dissociation constant of less than 50 nanomolar as determined by any conventional and recognized method, such as those described in Coligan et al., Current Protocols in Protein Science, Vol. 2, New York, John Wiley Sons, Inc., p. A.5A. 1-A.5A.40 (1998), incorporated herein by reference, is scored as binding to a receptor, and polypeptides with lower affinities are scored as non-binding.
It is well known in the literature that naturally occurring VEGF's are expressed as splice variants and/or as pre-protein molecules and/or as prepro-protein molecules that undergo proteolytic processing. Chimeric polypeptides of the invention include chimeric (hybrid) receptor binding domains as explained in the preceding paragraphs, and optionally may include additional upstream or downstream sequences from
IO
S-22naturally occurring VEGF's, including upstream and downstream sequences that are 0 Z present in mature isoforms of naturally occurring circulating VEGF's; and/or upstream O or downstream pro-peptide sequences that are removed during normal intracellular or extracellular processing. By way of illustration, the chimeric polypeptides described in Example I were prepared using residues 34-135 (SEQ ID NO: 2) of VEGF-A and using 112- 216 of human prepro-VEGF-C (SEQ [D NO: 22). Chimeric polypeptides Sof the invention include the peptides actually exemplified, and also include such I peptides modified by the addition of upstream or downstream VEGF-A or VEGF-C sequences from SEQ ID NOs: 2 or 22. With respect to VEGF-A/VEGF-C chimeric C 10 polypeptides as exemplified herein, the addition of upstream and downstream sequences that correspond with amino- and/or carboxyl- terminal sequences characteristic of natural VEGF-A or VEGF-C isoforms is particularly contemplated.
It is also well known in the literature to recombinantly express proteins with an initiator methionine, with a heterologous signal peptide, with one or more tag sequences to facilitate purification, as fusions with other polypeptides, and the like. It is also well known to modify polypeptides with glycosylation, pegylation, or other modifications, some of which improve stability, circulating half-life, or (in the case of glycosylation) may make the polypeptide more similar to endogenous vascular endothelial growth factors. Chimeric polypeptides according to the invention may comprise any such modifications and additions to the amino acid sequence derived from two or more naturally-occurring vertebrate vascular endothelial growth factor polypeptides.
In addition to chimeric molecules having different receptor binding profiles, an additional aspect of the invention includes chimeric molecules having increased receptor binding affinity. For example, the invention provides a chimeric polypeptide comprising a plurality of peptide subunits derived from two or more naturallyoccurring vertebrate vascular endothelial growth factor polypeptides, wherein the chimeric polypeptide binds at least one naturally-occurring vascular endothelial growth factor receptor with an increased binding affinity compared to the binding affinity of the two or more naturally-occurring vascular endothelial growth factors for the receptor. Chimeric molecules that bind a receptor with greater affinity than
ID
O -23naturally occurring VEGF's are among the preferred chimeric molecules of the O invention, even if the receptor binding profile for the chimeric molecules is identical O to that of a riatually occurring VEGF. Increased. receptor binding affinity is expected to correlate with great potency as receptor activators or inhibitors. Generally, dissociation constants (Kd) detennined by any accepted procedure are indicative of receptor affinity, with lower Kd indicative of greater binding affinity. Particularly y contemplated are chimeric molecules that display any reduction in Kd that is CN statistically significant at a level ofp 0.05 in side-by-side tests [see, Coligan et
ID
Sal., Current Protocols in Protein Science, Vol. 2, New York, John Wiley Sons, 10 Inc., p. A.5A.1-A.5A.40 (1998)] compared to naturally-occurring molecules from which the chimera was derived. Chimeras that show a twenty percent reduction in Kd increased binding affinity) with respect to a VEGF receptor are preferred.
Reductions of 33% or 50% are highly preferred. A 3-fold reduction a Kd of 33.3 pM for a chimeric polypeptide compared to a 100 pM Kd of a naturally occurring VEGF), 5-fold reduction, 10-fold reduction, or 20-fold reduction in dissociation constants or is very highly preferred.
Another related preferred class of chimeric molecules are those molecules that display any reduction in ECo, concentration that is statistically significant at a level of p 0.05 in side-by-side tests compared to naturally-occurring molecules from which the chimera was derived. Chimeras that show a twenty percent reduction in ECs increased binding affinity) with respect to a VEGF receptor are preferred. Reductions of 33% or 50% are highly preferred. ECo 0 or the half effective concentration, is the concentration that produces 50% of a maximal effect. An exemplary assay for determining the ECs, of a putative ligand for a specific receptor is set forth in Example 6, below.
The Examples set forth below provide a description of the synthesis and assaying of numerous specific hybrid polypeptides of the invention, every one of which is itself intended as an aspect of the invention. .A preferred group of hybrid polypeptides from among the exemplified polypeptides are polypeptides that comprise an amino acid sequence of the fonnula:
NH,-X,-X
2
-X
3
-X
4
-X
5
-X
6
-X,-X-X-COOH
IO
-24wherein X, comprises an amino acid sequence selected from the group consisting of
O
Z amino acids 3-11 of SEQ ID NO: 128 and amino acids 3-11 of SEQ ID NO:137; Swherein X 2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 129 and 138; wherein X 3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 130 and 139; wherein X 4 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 131 and S'1 140; wherein X s comprises an amino acid sequence selected from the group consisting
C
O of SEQ ID NOs: 132 and 141; wherein X 6 comprises an amino acid sequence selected 8 from the group consisting of SEQ ID NOs: 133 and 142; wherein X 7 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 134 and 143; wherein X, comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 135 and 144; wherein X, comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 136 and 145; wherein NH,-Xi-X 2
-X
3
-X
4 Xs-X 6
-X
7
-X
8 -X,-COOH is not identical to amino acids 34 to 135 of SEQ ID NO: 2 or amino acids 112 to 216 of SEQ ID NO: 22; and wherein the polypeptide binds to at least one receptor selected from the group consisting of human VEGFR-1, hlunan VEGFR-2, and human VEGFR-3. As described below in greater detail, each of the specified amino acid sequence pairs SEQ ID NO: 128 and 137) are encoded by a VEGF-A cDNA fragment or a VEGF-C cDNA fragment that align with each other when the receptor binding domains of VEGF-A and VEGF-C are aligned to maximize sequence homology, using standard alignment algorithms.
With respect to the foregoing genus of hybrid of polypeptides, one preferred subgenus comprises those polypeptides which bind to exactly one receptor selected from the group consisting of human VEGFR-1, human VEGFR-2, and human VEGFR-3. Initial screens suggest that the following specific constructs (described below in detail) satisfy this criteria: 82-14, 82-16, 22-3, 72-6, 12-14, 12-16, 32-9, 32- 11, 32-14, 32-15, 32-16, 52-9, 52-11, 52-14, 52-15, 14-7, 23-10, 23-12, 23-14, 33-1, 33-3, 33-6, 33-9, 53-1, 53-3, 53-7, 62-8, 62-10, 62-13, 63-3, 63-6, 73-7, 73-15, 74- 74-12, 11-9, 11-13, 12-1, 12-5, 81-9, 81-13, 13-9, 13-11, 13-13, 13-15, 14-1, 14-5, 41-1, 43-1, 83-9, 83-13, 83-15, 61-1, 61-3, 62-1, 82-5, 84-1, 84-5.
ID
Another preferred subgenus comprises those hybrid polypeptides that bind to z VEGFR-1 and VEGFR-3, but not to VEGFR-2. Initial screens suggest that the following specific constructs satisfy this criteria: 12-9, 12-13, 14-9, 82-9, 82-13, 84-9.
A highly preferred subgenus comprises hybrid polypeptides of the invention that bind VEGFR-I, VEGFR-2, and VEGFR-3. Initial screens suggest that the following specific constructs satisfy this criteria: 12-7, 12-11, 82-11, 84-11.
I) Other subgenuses include hybrid polypeptides that bind VEGFR-1 and C"1 VEGFR-2 (both of which are bound by VEGF-A) but not VEGFR-3; and hybrid Spolypeptides that bind VEGFR-2 and VEGFR-3 (both of which are bound by fully C" 10 processed VEGF-C) but not VEGFR-1.
As taught in greater detail below, the fourth fragment (X 4 appears to include residues that are important for conferring VEGFR-3 binding affinity. For this reason, another preferred genus of the hybrid polypeptides are those wherein X 4 comprises SEQ ID NO: 140, and wherein the polypeptide binds to VEGFR-3. Fragments 5 and 8 of VEGF-C also appear to contribute to VEGFR-3 binding. Thus, highly preferred are polypeptides further characterized by X, comprising SEQ ID NO: 141, and/or X 8 comprising SEQ ID NO: 144.
Similarly, the data below suggests that fragments 2 and 7 of VEGF-A contribute to VEGF-RI binding. Thus, another preferred gene of the hybrid polypeptides are those wherein X 2 comprises SEQ ID NO: 129, and wherein the polypeptide binds to VEGFR-1. In a highly preferred embodiment, X 7 comprises SEQ ID NO: 134. In an embodiment where it is desirous for this polypeptide also to bind to VEGFR-3, a preferred construct is one wherein X 4 comprises SEQ ID NO: 140. To confer VEGFR-3 binding, it is still more preferable for X 5 to comprise SEQ ID NO: 141, and/or for X 8 to comprise SEQ ID NO: 144.
The recombination experiments described below to generate hybrid molecules were performed only with receptor binding domains of human VEGF-A and VEGF-C, rather than with sequences corresponding to natural secreted forms of VEGF-A and VEGF-C or pre-protein or prepro-protein sequences. However, routine recombinant DNA techniques, such as those described in Ausubel, et al. Protocols in Molecular Biology, John Wiley Sons (1994-1999) or Sambrook et (Eds.), 0 S-26- >Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press: 0 Z Cold Spring Harbor, New York (1989), can be used to join polynucleotides encoding O the hybrid proteins with polynucleotides encoding VEGF-A or VEGF-C sequences that are found upstream or downstream of the receptor binding domain in naturally- S 5 occurring proteins, especially sequences found in naturally-occurring secreted and circulating forms of VEGF-A or VEGF-C.
Thus, the invention provides a polypeptide comprising an amino acid sequence of the formula XN- V/PIID Xc, wherein X, is selected from the group consisting of amino acids 1-34 of SEQ ID NO: 2, amino acids 1-111 of SEQ ID NO: 22, amino acids 1-34 of SEQ ID NO: 147, or fragments thereof, wherein V/PHD is a chimeric polypeptide as described elsewhere herein; wherein X c is selected from the group consisting of amino acids 136-191 of SEQ ID NO: 2, amino acids 217-419 of SEQ ID NO: 22, amino acids 136-232 of SEQ ID NO: 147, or fragments thereof; and wherein X, and Xc are each identical to amino acid sequence in a naturally occurring human VEGF-A or VEGF-C precursor protein or a naturally occurring human VEGF-A or VEGF-C isoform.
In one specific variation, the invention provides hybrid polypeptides as described above, wherein the polypeptide further includes one or more amino acid sequences selected from the group consisting ofa prepro-VEGF-C signal peptide, a prepro-VEGF-C amino-tenninal propeptide, and a prepro-VEGF-C carboxy-terminal pro-peptide.
SExpression of hybrid polypeptides of the invention is not restricted to expression only with naturally-occurring flanking VEGF-A or VEGF-C sequences, however. Expression of polypeptides of the invention in bacteria may be accomplished by including an initiator methionine or methionine-lysine upstream of the hybrid VEGF sequences, whereas expression and secretion in mammalian cells is most conveniently accomplished by including at least a signal peptide. Thus, in one embodiment, the invention provides a polypeptide as described above, wherein the polypeptide further includes an amino terminal methionine residue or an aminoterminal Met-Lys sequence. In another embodiment, the polypeptide further includes
ID
S-27a signal peptide amino acid sequence connected to the amino acid sequence of the 0 formula NH,-X,-X 2
-X
3
-X-X-X-X-X-X-COOH.
0 Expression of polypeptides of the invention as fusions with other heterologous sequences, such as tag sequences to facilitate purification or expression as part of larger fusion peptides also is contemplated. An exemplary tag of this type is a polyhistidine sequence, generally around six histidine residues, that permits isolation of a compound so labeled using nickel chelation. Other labels and tags, such as the FLAG tag (Eastman Kodak, Rochester, NY), well known and routinely used in the art, are embraced by the invention. Exemplary fusions include use of commercially
O
C" 10 available vectors that express a desired polypeptide as part of glutathione-S-transferase (GST) fusion product. After cleavage of the GST component from the desired polypeptide, an additional glycine residue at position -1 may remain. Variants which result from expression in other vector systems are also contemplated.
By virtue of the receptor binding and activity assays described herein, the present application also provides variants (analogs) of the hybrid polypeptides of the invention, wherein one or more amino acids of the hybrid peptide amino acid sequence has been added, deleted, or substituted by another amino acid, and wherein the hybrid retains the receptor binding and/or a biological activity characteristic of the hybrid polypeptide.
Substitution variants wherein merely conservative substitutions have been introduced by modification of polynucleotides encoding polypeptides of the invention) are intended as equivalents of hybrid polypeptides of the invention. Amino acids can be classified according to physical properties and contribution to secondary and tertiary protein structure. A conservative substitution is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties.
Exemplary conservative substitutions based on amino acid side chain properties are set out in the table immediately below, using standard one letter abbreviations.
SIDE CHAIN
CHARACTERISTIC
Aliphatic Non-polar Polar-uncharged Polar-charged Aromatic Other AMINO ACID G, A, P, I, L, V C, S, T, M, N, Q D, E, K, R
F,W,Y
N, Q, D, E Alternatively, conservative amino acids can be grouped as described in Lehringer, [Biochemistry, Second Edition Worth Publishers, Inc. NY NY (1975), pp. 71-77] as set out in the table immediately below.
Non-polar (hydrophobic) side chain Aliphatic Aromatic Sulfur-containing: Borderline Uncharged-polar side chain Hydroxyl: Amides: Sulfhydryl: Borderline: Positively Charged (Basic): Negatively Charged (Acidic) A, L, I, V, P F, W
M
G
S, T, Y
N,Q
C
G
K,R,H
D, E O -29- The following table provides still an another alternative, exemplary set of O conservative amino acid substitutions. Both one letter and three letter abbreviations z are shown: Original Conservative Residue S Substitutions Ala Val, Leu, Ile e Arg Lys, Gin, Asn O Asn Gin, His, Lys, Arg Asp Glu Cys(C) Ser Gln Asn Glu Asp His Asn, Gin, Lys, Arg Ile Leu, Val, Met, Ala, Phe, Leu Ile, Val, Met, Ala, Phe Lys Arg, Gin, Asn Met Leu, Phe, Ile Phe Leu, Val, Ile, Ala Pro Gly Ser Thr Thr Ser Trp Tyr Tyr Trp, Phe, Thr, Ser Val lie, Leu, Met, Phe, Ala For many proteins, the effects of any individual or small group of amino acid changes is unlikely to significantly alter biological properties, especially if the changes are conservative substitutions, provided the changes are not introduced at critical residues. Preferred variants of the hybrid polypeptides of the invention share at least ID O about 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid identity with
O
0 hybrids that consist entirely of amino acid sequences derived from naturally occurring VEGF's.
Identity and similarity of related nucleic acid molecules and polypeptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, ed., Oxford t r University Press, New York, 1988; Biocolnputing: Informatics and Genome Projects, Cl, Smith, ed., Academic Press, New York, 1993; Computer Analysis of Sequence O Data, Part 1, Griffin, and Griffin, eds., Humnana Press, New Jersey, 1994; C1 10 Sequence Analysis in Molecular Biology, von Heinje, Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, eds., M. Stockton Press, New York, 1991; and Carillo et al., SIAM J. Applied Math., 48: 1073 (1988).
Preferred methods to determine identity and/or similarity are designed to give the largest match between the sequences tested. Methods to detennine identity and similarity are described in publicly available computer programs. Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res., 12:387 (1984); Genetics Computer Group, University of Wisconsin, Madison, WI), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol., 215:403-410 (1990)). The BLASTX program is publicly available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, MD 20894; Altschul et al., supra). The well known Smith Waterman algorithm may also be used to determine identity.
Preferred parameters for a polypeptide sequence comparison include the following: Algorithm: Needleman et al., J. Mol. Biol., 48, 443-453 (1970); Comparison matrix: BLOSUM 62 from Henikoff et al., Proc. Natl. Acad.
Sci. USA, 89: 10915-10919 (1992); Gap Penalty: 12 Gap Length Penalty: 4 Threshold of Similarity: 0
ID
S-31- Preferred parameters for nucleic acid molecule sequence comparisons include 0 the following: 0 Algorithm: Needleman et al., J. Mol Biol., 48: 443-453 (1970); Comparison matrix: matches +10, mismatch 0 Gap Penalty: Gap Length Penalty: 3 C Thus, in still another embodiment, the invention provides a polypeptide
ID
C comprising a non-naturally occurring vascular endothelial growth factor amino acid N 10 sequence, wherein said non-naturally occurring vascular endothelial growth factor amino acid sequence consists of an amino acid sequence that is at least 95% identical to an amino acid sequence of the formula:
NH
2
-X,-X
2
-X
3
-X
4
-X
5
-X
6
-X
7 -X-Xg-COOH wherein X, comprises an amino acid sequence selected fronm the group consisting of amino acids 3-11 of SEQ ID NO: 128 and amino acids 3-11 of SEQ ID NO: 137; wherein X 2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 129 and 138; wherein X 3 complises an amino acid sequence selected from the group consisting of SEQ ID NOs: 130 and 139; wherein X 4 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 131 and 140; wherein X, comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 132 and 141; wherein X, comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 133 and 142; wherein X 7 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 134 and 143; wherein X, comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 135 and 144; wherein X, comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 136 and 145; and wherein the polypeptide binds to at least one receptor selected from the group consisting of human VEGFR-1, human VEGFR-2, and human VEGFR-3. In a preferred embodiment, NI- 2
-X-X
2
-X
3
X
4
-X,-X
6
-X
7
-X
8 -Xg-COOH is not identical to amino acids 34 to 135 of SEQ ED NO: 2 or amino acids 112 to 216 of SEQ ID NO: 22.
IO
0 -32- By "non-naturally occurring vascular endothelial growth factor amino acid 0 Ssequence" is meant a sequence that is not identical to any knlown, naturally occurring 0amino acid sequence, such as, in this case, receptor binding domains from known VEGF-A or VEGF-C sequences.
Stated more generally, the invention provides a polypeptide that comprises an amino acid sequence that is at least about 70%, 80%, 90%, 95%, 96%, 97%, 98%, or c 99% identical to any specific amino acid sequence of the invention, and that binds at Sleast one of the naturally-occurring vascular endothelial growth factor or platelet Sderived growth factor receptors, and that has a different receptor binding profile or an improved receptor binding affinity than a naturally-occurring growth factor polypeptide. Polypeptides that satisfy the percent identity criteria and that display the same receptor binding profile as the referent polypeptide are especially contemplated.
For example, the invention provides a polypeptide that comprises an amino acid sequence that is at least about 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences encoded by constnucts 12-7 (SEQ ID NO: 63), 12-11 (SEQ ID NO: 71), 82-11, or 84-11, wherein the polypeptide binds VEGFR-1, VEGFR-2, and VEGFR-3.
In yet another aspect, the invention provides a dimeric protein molecule comprising a first polypeptide associated with a second polypeptide, wherein at least one of the polypeptides is a polypeptide according to the present invention. The association between the polypeptides may be by way of covalent bonding disulfide bonding) or non-covalent bonding of polypeptide chains hydrogen bonding, bonding due to stable or induced dipole-dipole interactions, bonding due to hydrophobic or hydrophilic interactions, combinations of these bonding mechanisms, and the like).
In another embodiment, the invention provides polynucleotides cDNA, cDNA with introns introduced to facilitate expression in eukaryotic systems, synthetic DNA, RNA, or combinations thereof, single or double stranded) that comprise a nucleotide sequence encoding the amino acid sequence of the polypeptides of the invention. Purified and isolated polynucleotides are preferred. Due to the wellknown degeneracy of the genetic code, several polynucleotides sequences exist that
OD
o -33encode each polypeptide amino acid sequence of the invention. Such polynucleotides are useful for recombinantly expressing the polypeptides of the invention.
The invention also embraces polynucleotides dtha encode VEGF receptor binding polypeptides and that hybridize under moderately stringent or high stringency conditions to the complete non-coding strand, or complement, of the polynucleotides specifically described herein that encode VEGF receptor binding polypeptides. This It) genus of polynucleotides embraces polynucleotides that encode polypeptides with one Sor a few amino acid differences (additions, insertions, or deletions) relative to amino
ID
Sacid sequences specifically taught herein. Such changes are easily introduced by performing site directed mutagenesis, for example, or by substituting a fragment from a non-human ortholog VEGF-A or VEGF-C polypeptide for a fragment of a human VEGF-A or VEGF-C polypeptide used to construct the hybrid polypeptides of the invention.
Exemplary highly stringent hybridization conditions are as follows: hybridization at 65 0 C for at least 12 hours in a hybridization solution comprising SSPE, 5X Denhardt's, 0.5% SDS; and 2 mg sonicated non-homologous DNA per 100 ml of hybridization solution; washing twice for 10 minutes at room temperature in a wash solution comprising 2X SSPE and 0.1% SDS; followed by wasling once for minutes at 65°C with 2X SSPE and 0.1% SDS; followed by a final wash for minutes at 65C with 0.1X SSPE and 0.1% SDS. Moderate stringency washes can be achieved by washing with 0.5X SSPE instead of 0. X SSPE in the final 10 minute wash at 65"C. Low stringency washes can be achieved by using IX SSPE for the minute wash at 65C, and omitting the final 10 minute wash. It is understood in the art that conditions of equivalent stringency can be achieved through variation of temperature and buffer, or salt concentration as described Ausubel, et al. (Eds.), Protocols in Molecular Biology, John Wiley Sons (1994), pp. 6.0.3 to 6.4.10.
Modifications in hybridization conditions can be empirically determined or precisely calculated based on the length and the percentage of guanosine/cytosine (GC) base pairing of the probe. The hybridization conditions can be calculated as described in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press: Cold Spring Harbor, New York (1989), pp. 9.47 to 9.51.
O
-34- For example, the invention provides a polynucleotide that comprises a nucleotide 0 Z sequence that hybridizes under moderately stringent or high stringency hybridization 0 conditions lo any specific nucleotide sequence of the invention, and that encodes a polypeptide that binds at least one of the naturally-occurring vascular endothelial growth factor or platelet derived growth factor receptors, and that has a different receptor binding profile or an improved receptor binding affinity than a naturally- Soccurring growth factor polypeptide. Polynucleotides that satisfy the hybridization N criteria and that display the same receptor binding profile as the referent Spolynucleotide are especially contemplated. For example, the invention provides a polynucleotide that comprises a nucleotide sequence that hybridizes under moderately stringent or high stringency hybridization conditions to the nucleotide sequences taught herein for constructs 12-7 (SEQ ID NO: 62), 12-11 (SEQ ID NO: 70), 82-11, or 84-11, wherein the polynucleotide encodes a polypeptide that binds VEGFR-1, VEGFR-2, and VEGFR-3.
In a related embodiment, the invention provides a polynucleotide that comprises a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to any specific nucleotide sequence of the invention, and that encodes a polypeptide that binds at least one of the naturally-occurring vascular endothelial growth factor or platelet derived growth factor receptors, and that has a different receptor binding profile or an improved receptor binding affinity than a naturallyoccurring growth factor polypeptide. Polynucleotides that satisfy the percent identity criteria and that display the same receptor binding profile as the referent polynucleotide are especially contemplated. For example, the invention provides a polynucleotide that comprises a nucleotide sequence that is at least 95% identical to the nucleotide sequences taught herein for constructs 12-7 (SEQ ID NO: 62), 12-11 (SEQ ID NO: 70), 82-11, or 84-11, wherein the polynucleotide encodes a polypeptide that binds VEGFR-1, VEGFR-2, and VEGFR-3.
In a related embodiment, the invention provides vectors comprising a polynucleotide of the invention. Such vectors are useful, for amplifying the polynucleotides in host cells to create useful quantities thereof. In preferred embodiments, the vector is an expression vector wherein the polynucleotide of the
NO
8 invention is operatively linked to a polynucleotide comprising an expression control O sequence. Autonomously replicating recombinant expression constructs such as O plasniid and viral DNA vectors incorporating polynucleolides of the invention are specifically contemplated. Expression control DNA sequences include promoters, enhancers, and operators, and are generally selected based on the expression systems in which the expression construct is to be utilized. Preferred promoter and enhancer sequences are generally selected for the ability to increase gene expression, while CN operator sequences are generally selected for the ability to regulate gene expression.
ID
Expression vectors are useful for recombinant production of polypeptides of the S 10 invention. Expression constructs of the invention may also include sequences encoding one or more selectable markers that pennit identification of host cells bearing the construct. Expression constructs may also include sequences that facilitate, and preferably promote, homologous recombination in a host cell. Preferred constructs of the invention also include sequences necessary for replication in a host cell.
Vectors also are useful for "gene therapy" treatment regimens, wherein a polynucleotide that encodes a polypeptide of the invention is introduced into a subject in need of treatment involving the modulation (stimulation or blockage) of vascular endothelial growth factor receptors, in a form that causes cells in the subject to express the polypeptide of the invention in vivo.
In another related embodiment, the invention provides host cells, including prokaryotic and eukaryotic cells, that are transformed or transfected (stably or transiently) with polynucleotides of the invention or vectors of the invention.
Polynucleotides of the invention may be introduced into the host cell as part of a circular plasmid, or as linear DNA comprising an isolated protein coding region or a viral vector. Methods for introducing DNA into the host cell well known and routinely practiced in the art include transformation, transfection, electroporation, nuclear injection, or fusion with cariers such as liposomes, micelles, ghost cells, and protoplasts. As stated above, such host cells are useful for amplifying the polynucleotides and also for expressing the polypeptides of the invention encoded by the polynucleotide. Such host cells are useful in assays as described herein. For -36expression of polypeptides of the invention, any host cell is acceptable, including but 0 Snot limited to bacterial, yeast, plant, invertebrate insect), vertebrate, and mannalian host cells. For developing thlerapeutic preparations, expression in mammalian cell lines, especially hunan cell lines, is preferred. Use of mammalian host cells is expected to provide for such post-translational modifications glycosylation, truncation, lipidation, and phosphorylation) as may be desirable to confer optimal biological activity on recombinant expression products of the Sinvention. Glycosylated and non-glycosylated fonns of polypeptides are embraced by Sthe present invention. Similarly, the invention further embraces polypeptides l 10 described above that have been covalently modified to include one or more water soluble polymer attachments such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol.
Polypeptides of the invention also may be chemically synthesized.
In still another related embodiment, the invention provides a method for producing a vascular endothelial growth factor receptor binding protein, comprising the steps of growing a host cell of the invention in a nutrient medium and isolating the polypeptide or variant thereof from the cell or the medium. Isolation of the polypeptide from the cells or from the medium in which the cells are grown is accomplished by purification methods known in the art, conventional chromatographic methods including immunoaffinity chromatography, receptor affinity chromatography, hydrophobic interaction chromatography, lectin affinity chromatography, size exclusion filtration, cation or anion exchange chromatography, high pressure liquid chromatography (HPLC), reverse phase HPLC, and the like. Still other methods of purification include those wherein the desired protein is expressed and purified as a fusion protein having a specific tag, label, or chelating moiety that is recognized by a specific binding partner or agent. The purified protein can be cleaved to yield the desired protein, or be left as an intact fusion protein. Cleavage of the fusion component may produce a form of the desired protein having additional amino acid residues as a result of the cleavage process.
Also within the scope of the invention are compositions comprising polypeptides or polynucleotides of the invention. In a preferred embodiment, such O -37compositions comprise one or more polynucleotides or polypeptides of the invention 0 that have been formulated with a pharmaceutically acceptable sterile and non- O toxic) diluent or carrier. Liquid, semisolid, or solid diluents thai serve as phannaceutical vehicles, excipients, or media are preferred. Any diluent known in the art may be used. Exemplary diluents include, but are not limited to, water, saline solutions, polyoxyethylene sorbitan monolaurate, magnesium stearate, methyl- and propylhydroxybenzoate, talc, alginates, starches, lactose, sucrose, dextrose, sorbitol, C' mannitol, glycerol, calcium phosphate, mineral oil, and cocoa butter. Such Sformulations are useful, for administration of polypeptides or polynucleotides of 0 C 10 the invention to mammalian (including human) subjects in therapeutic regimens.
Similarly, the invention provides for the use of polypeptides or polynucleotides of the invention in the manufacture of a medicament for the treatment of disorders described herein, including but not limited to disorders characterized by undesirable endothelial cell proliferation and/or disorders characterized by ischemia and/or vessel occlusion, wherein neovascularization is desirable.
In a related embodiment, the invention provides a kit comprising a polynucleotide, polypeptide, or composition of the invention packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to treat one or more disease states as described herein.
In yet another aspect, the present invention provides methods of producing polypeptides having novel VEGF receptor binding and stimulation properties, and methods for producing polynucleotides that encodes such polypeptides. For example, the invention provides a method for making a polynucleotide that encodes a polypeptide that modulates the growth of mammalian endothelial cells or mammalian pericytes/smooth muscle cells; comprising the steps of: preparing polynucleotides that encode amino acid fragments of at least two vertebrate vascular endothelial growth factor polypeptides; commingling the polynucleotides under conditions wherein the polynucleotides recombine to form hybrid polynucleotides; expressing the hybrid polynucleotides to make hybrid polypeptides encoded by the hybrid polynucleotides; screening the hybrid polypeptides to identify a hybrid polypeptide that binds to a 0 Z receptor for a vertebrate vascular endothelial growth factor; and selecting the 0 polynucleotile that encodes the hybrid polypeptide that binds to the receptor in the screening step. Expression of the selected polynucleotide (to produce the desired polypeptide) also is contemplated.
In this context, "modulate the growth of mammalian endothelial cells" means stimulate such growth by inducing a mitogenic signal through binding cell surface i receptors expressed on vascular endothelial cells, or inhibiting such growth. As explained elsewhere herein, inhibition may be due to blockage of vascular endothelial growth factor receptors, or the formation of heterodimers with endogenous growth factors that prevent stimulation of endogenous receptors by the endogenous growth factors. Inhibition also may be achieved by conjugating cytotoxic agents to polypeptides of the invention that bind VEGF receptors. Exemplary toxins are known in the art and described elsewhere herein. Polypeptides of the invention conjugated to cytotoxic agents or other agents that modulate cell growth are contemplated as another aspect of the invention.
In this context, "vertebrate vascular endothelial growth factor polypeptides" again means polypeptides having the following characteristics: the polypeptide is encoded by genomic DNA of a vertebrate a reptile, amphibian, bird, or mammal, preferably a bird or mammal, most preferably a mammal; especially a primate mammal such as a monkey, ape, or human) or is encoded by the genome of a vertebrate pathogen such as mammalian pox viruses; the polypeptide comprises all or a portion of a coding sequence that is expressed by a vertebrate from transcription/translation of the vertebrate's genomic DNA or from virally-induced transcription/translation, in the case of polypeptides encoded by viral nucleic acids); the polypeptide or portion comprises a VEGF homology domain (V/PHD) of about 70-150 amino acids that binds to naturally occurring receptors and that is characterized in part by the amino acid motif: C-X(18-28)-P-X-C-X(4)-R-C-X-G-C(1- 2)-X(6-12)-C-X(30-46)-C, where X represents any amino acid and numbers in parentheses represent a permissible range of amino acids X(18-28) represents a
ID
-39stretch of any 18-28 amino acids; C(1-2) represents one or two cysteine residues).
O The V/PHD includes eight conserved cysteines which form a cysteine knot motif similar to Ihat found in human vascular endclhelial growth factors A, B, C, and D (VEGF-A, and and human platelet-derived growth factor (PDGF).
Preferred polypeptides or portions comprise a VPHD that is characterized by the more particular amino acid motif C-X(22-24)-P-[PSR]-C-V-X(3)-R-C-X-G-C-C-X(6)-C- X(32-4 where amino acids in brackets [PSR]) represent alternatives for a C single position in the amino acid sequence; and
I
0 the polypeptide binds to at least one cell surface receptor that is expressed C, 10 on endothelial cells that line vertebrate blood or lymphatic vessels or pericytes/smooth muscle cells that line and support blood vessels. Preferred polypeptides bind to a least one cell surface receptor that is expressed on endothelial cells..
Several methods exist for practicing the preparing step. In one variation, single-stranded oligonucleotides are prepared based on knowledge of mammalian VEGF polypeptide sequences and the universal genetic code and using conventional chemical synthesis techniques. Example 1 below demonstrates such a technique, wherein synthetic oligonucleotide pairs were prepared and annealed to prepare double-stranded polynucleotides having single-stranded cohesive ends that encoded fragments of human VEGF-A and human VEGF-C. In another variation, cDNAs or genomic DNAs (preferably cDNAs) encoding natural VEGF's are fragmented using one or more restriction endonucleases, using DNaseI, or using Exonuclease M. [See, Chang et al., Nature Biotechnology, 17: 793-797 (1999) (DNaseI procedure); Kikuchi et al., Gene, 236: 159-167 (1999) (restriction endonuclease procedure); Harayama et al., TIBTECH, 16: 76-82 (1998) (review); Patten et al., Curr. Opin.
Biotechnology, 8: 724-733 (1997) (review, DNase Zhang et al., Proc. Natl. Acad.
Sci. USA, 94: 4504-09 (1997) (DNase I procedure); Stemmer, Proc. Natl. Accd. Sci.
USA, 91:10747-1074 (1997) (DNase I procedure); Stemnmer, Nature, 370: 389-391 (1994) (DNase I procedure); and Ostermeier et al., Nature Biotechnology, 17: 1205- 1209 (1999) (ExoIl procedure), all incorporated herein by reference in their entirety].
In still another variation, a cDNA (coding or non-coding strand) is used as a template to synthesize complementary fragments, using DNA polymerase and chain-
NO
termination reagents. [See, Lehtovaara et al., Protein Engineering, 2: 63-68 0 Z (1988), incorporated by reference.] O Several methods also exist for practicing the comingling step. In one variation, the polynucleotides are prepared with complementary cohesive singlet" 5 stranded ends, to facilitate annealing of fragments in a desired order under conventional annealing and ligation conditions for polynucleotides. Example 1 below Cc provides a demonstration of this technique to generate 510 human VEGF-A/VEGF-C kO hybrids. Such a technique also may be suitable for annealing fragment mixtures of two or more VEGF cDNAs that have been digested with restriction endonucleases.
Alternatively, the commingling step is accomplished by mixing the polynucleotides and subjecting them to a self-priming PCR reaction that involves successive steps of denaturation, annealing, and extension. [See, Chang et al (1999); Kikuchi et al.
(1999); Patten et al. (1997); Zhang et al. (1997); Stemmer Proc. Natl. Accd. Sci. USA, 91: 10747-1074 (1994); and Stemmer, Nature, 370:389-391 Optionally, the PCR is performed under conditions that introduce errors (mutations) in the PCR products. Such mutations introduce additional molecular variation, and are expected to reduce the overall percentage of biologically active molecules, but also may produce molecules with unexpectedly superior activities.
After synthesizing the hybrid DNA molecules, the molecules are expressed by any means known in the art. In one variation the molecules are cloned into expression vectors, which are in turn used to transform or transfect cells to express the polypeptides. In another variation, the polynucleotides are cloned into a phage display vector system for screening. [See, Chang et al (1999).] The screening assay may entail a direct receptor binding assay as described below in Example 3. Alternatively, receptor binding may be assayed indirectly by assaying for a biological activity induced by receptor binding. Thus, in one variation, the screening step comprises contacting the hybrid polypeptide to a cell that expresses the receptor, wherein changes in cell growth or cell survival induced by the hybrid polypeptide is indicative of binding between the hybrid polypeptide and the receptor.
In a preferred variation of the method, the screening and selecting steps are designed to select polynucleotides that encode polypeptides that have novel receptor
ID
-41-
(N
binding profiles not possessed by the naturally occurring VEGFs from which the 0 polypeptide was derived. For example, the method is practiced wherein the screening step comprises screening to identify a hybrid polypeptide that binds lhumian VEGFR-1 and human VEGFR-3, and the selecting step comprises selecting a hybrid polypeptide that binds human VEGFR-1 and human VEGFR-3, but fails to bind human VEGFR- 2. Alternatively, the method is practiced whereby the screening step comprises n) screening to identify a hybrid polypeptide that binds human VEGFR-1, VEGFR-2, CN and human VEGFR-3, and the selecting step comprises selecting a hybrid polypeptide 0that binds human VEGFR-1, VEGFR-2, and human VEGFR-3.
c 10 In a related embodiment, the invention provides a method for making a polynucleotide that encodes a polypeptide that modulates the growth of mammalian endothelial cells, comprising the steps of: preparing a set of polynucleotide fragments having the following characteristics: the set includes a first subset of coding polynucleotide fragments, wherein each coding polynucleotide fragment of the .first subset encodes at least four amino acids of the amino acid sequence of a first mammalian vascular endothelial growth factor; (ii) the set includes a second subset of coding polynucleotide fragments, wherein each coding polynucleotide fragment.of the second subset encodes at least four amino acids of the amino acid sequence of a second mammalian vascular endothelial growth factor; commingling the polynucleotide fragments which comprise the set under conditions wherein the coding polynucleotide fragments from the first and second subsets recombine to form hybrid polynucleotides; expressing the hybrid polynucleotides to make hybrid polypeptides encoded by the hybrid polynucleotides; screening the hybrid polypeptides to identify a hybrid polypeptide that modulates the growth of mammalian endothelial cells; and selecting the polynucleotide that encodes the hybrid polypeptide that modulates the growth of mammalian endothelial cells in the screening step.
Practice of these methods of generating hybrid polynucleotides using mammalian vascular endothelial growth factors that comprise a receptor binding domain characterized by eight cysteines that are conserved in human Vascular Endothelial Growth Factor A (VEGF-A), human Vascular Endothelial Growth Factor -42- B (VEGF-B), human Vascular Endothelial Growth Factor C (VEGF-C), and human 0 z Vascular Endothelial Growth Factor D (VEGF-D) is preferred. Exemplary starting 0 molecules include VEGF-A VEGF-B, VEGF-C, VEGF-D, VEGF-E, P1GF, PDGF-A, and PDGF-B polypeptides of human and other mammals. Also included is the recently described protein, fallotein, disclosed in the EMBL database (Acc. No.
AF091434) (SEQ ID NO: 149), which has structural characteristics of the PDGF/VEGF family of growth factors. Thus, it is also contemplated to use fallotein Cl¢ N in generating hybrid proteins together with other mammalian VEGFs.
SThe polynucleotide and encoded polypeptide products of the foregoing CI 10 methods are themselves considered to be additional aspects of the present invention.
Antibodies that may be generated against polypeptides of the invention, and that bind polypeptides of the invention with. an affinity greater than for any natural occurring VEGF, also are contemplated as aspects of the invention. Polypeptides comprising the antigen-binding fragments of such antibodies also are contemplated as an aspect of the invention. Antibodies that bind to the polypeptides of the invention but not to vertebrate VEGF's are contemplated.
In yet another embodiment, the invention provides numerous in vitro and in vivo methods of using polypeptides and polynucleotides of the invention. Such methods are described in greater detail below in the Detailed Description. Generally speaking, polypeptides of the invention are useful for modulating (stimulating or inhibiting) cellular processes that are mediated through any of the PDGF/VEGF family of receptors, such as PDGFR-a, PDGFR-P, VEGFR-1, VEGFR-2, and/or VEGFR-3. These receptors may be involved singularly in certain processes and in combination, to varying extents, in other processes. Polypeptides of the invention possess many different receptor binding profiles, and one of the advantages of the invention is the ability to select a polypeptide with a receptor binding profile that matches the receptor expression profile of the biological process to be modulated.
Thus, in one variation, the invention provides a method of modulating the signaling of one or more ofPDGFR-a, PDGFR-P, VEGFR-1, VEGFR-2, and/or VEGFR-3 in a cell, comprising the step of contacting a cell that expresses one or more of PDGFR-a, PDGFR-P, VEGFR-1, VEGFR-2, and/or VEGFR-3 with a IO 41 composition comprising a polypeptide of the invention. In one variation, modulation to activate signaling is contemplated, and the cell is contacted with a polypeptide of the z invention that stimulates receptor signaling in an amount sufficient to bind to the one or more receptors and induce receptor signaling. In another variation, modulation to inhibit signaling is contemplated. The cell is contacted with a polypeptide that inhibits ligand-induced receptor activation (or a polypeptide conjugated to a cytotoxin), in an amount sufficient to inhibit signaling that is induced by receptor ligand growth factor polypeptides that exist endogenously in the cell's environment. Dose-response studies pennit accurate determination of a proper quantity of polypeptide to employ. Effective 10 quantities can be estimated from measurements of the binding affinity of a polypeptide Sfor a target receptor, of the quantity of receptor present on target cells, of the expected dilution volume patient weight and blood volume for in vivo embodiments), and of polypeptide clearance rates.
In another variation, the invention provides a method of modulating the signaling of one or more of PDGFR-a, PDGFR-p, VEGFR-1, VEGFR-2, and/or VEGFR-3, comprising the step or administering to a patient in need of modulation of the signaling of one or more of these receptors a composition comprising a polynucleotide of the invention, under conditions in which cells of the patient are transformed or transfected by the polynucleotide and express the polypeptide of the invention encoded thereby, wherein the expressed polypeptide modulates signaling of the one or more receptors.
As discussed below, analysis of the chimeras receptor binding properties and the sequences of VEGFR-3 ligands in relation to the sequence of VEGF-A suggests that Fragments 4 and 5 from the VEGF-C molecule are important for conferring VEGFR-3 binding affinity, and in particular the sequence of residues TNTFxxxP (SEQ ID NO: 1204) found within Fragments 4 and 5. Thus, in another variation, the invention provides molecules designed using these core residues and other substituents to modulate VEGFR-3 biological activity. For example, in one embodiment, the invention provides a molecule comprising the peptide sequence TNTFXnP (SEQ ID NO: 1212), wherein X, comprises from one to seven amino acids, and wherein the molecule inhibits VEGF-C-mediated activation of VEGFR-3. The molecule may include additional residues or I 44 C1 organic moieties. In one variation, it is contemplated that this epitope will be linked by O a non-VEGF-C amino acid sequence to other epitopes involved in receptor binding, Z thereby creating a molecule capable of interacting with receptor loci involved in ligand binding and blocking ligand-mediated activation of the receptor. In a preferred embodiment, Xn comprises three amino acids, which represents the same amino acid spacing as native VEGF-C.
In a related embodiment, the invention provides a molecule comprising the tn human VEGF-C peptide sequence EFGVATNTFFKPPCVSVYRCG (SEQ ID NO: CN 1205) or a fragment or variant thereof, wherein the molecule inhibits VEGF-Cmediated activation of VEGFR-3. In one variation, the fragment is such that the molecule comprises the amino acid sequence EFGVATNTFFKPPCVSVYRCG
(SEQ
ID NO: 1205). In another variation, the fragment is such that the molecule comprises the amino acid sequence TNTFFKPP (SEQ ID NO: 1206). In still another variation, the fragment or variant comprises the amino acid sequence TNTFFKPPCVxxxR (SEQ ID NO: 1207), or the amino acid sequence TNTFFKPPCVxxxRCGGCC (SEQ ID NO: 1208).
Data relating to binding properties and sequence of chimeric molecules of the invention also provides insight into the important amino acid targets for synthetic design of modulators of receptor/ligand interactions. For example, in one embodiment, the invention provides a method for identifying a modulator of VEGFR-1 binding to VEGF-A comprising the steps of measuring binding between VEGFR-1 and VEGF- A in the presence and absence of a test compound under conditions that allow binding of VEGFR-1 to VEGF-A, and (ii) identifying as a modulator a test compound which alters VEGFR-1 binding to VEGF-A and which binds VEGF-A at a site defined by Phe43, Met, Tyr 47 Gin 48 Tyr 5 Gino 05 and Met'o7 of SEQ ID NO 2, or which binds VEGFR-I at VEGFR-1 residues which interface with said residues of SEQ ID NO 2.
Modulators that act as inhibitors, and are useful for ameliorating conditions characterized by undesirable or excessive ligand-mediated receptor activation, are a preferred class of modulators. Activators are another preferred class.
In a related embodiment, the invention provides a method for identifying a modulator of VEGFR-1 binding to VEGF-A comprising the steps of(i) measuring binding between VEGFR-1 and VEGF-A in the presence and absence of a test
D
O compound under conditions that allow binding of VEGFR-1 to VEGF-A, and (ii) 0 identifying as a modulator a test compound which alters VEGFR-I binding to VEGF- O A and which hinds VEGF-A at a site defined by Lys" 2 Phe'", Mel Tyr", Gin 8 'Tyr 5 le 72 Lys", Asp 69 Gly 9 1 Leu", Gln' 5 o, Met 10 7 110 l 9 Phe", His"2, Gin'", le" 7 Glu' 2 9 Arg' 31 and Pro' 32 of SEQ ID NO: 2, or which binds VEGFR-I at VEGFR-1 residues which interface with said residues of SEQ ID NO: 2.
I) Similarly, the invention provides a method for identifying a modulator of CI VEGFR-3 binding to VEGF-C comprising the steps of(i) measuring binding between 0 VEGFR-3 and VEGF-C in the presence and absence of a test compound under C' 10 conditions that allow binding of VEGFR-3 to VEGF-C, and (ii) identifying as a modulator a test compound which alters VEGFR-3 binding to VEGF-C and which binds VEGF-C at a site defined by Lys'" 2 Ser' 2 Ile 1 22 Trp' 26 Arg 2 7 Gin' 3 0 Phesi 1 Lys'" Ser' 68 Gly 1 70 Leu" Tyr 8 Phe' 18 Ile 1 9 Pro' 1 Pro' 9 Pro' 98 Arg 2 1 0 Met 21 2 and Ser'" of SEQ ID NO: 22, or which binds VEGFR-3 at VEGFR-3 residues which interface with said residues of SEQ ID NO: 22. The invention also provides a method for identifying a modulator of VEGFR-3 binding to VEGF-C comprising the steps of measuring binding between VEGFR-3 and VEGF-C in the presence and absence of a test compound under conditions that allow binding of VEGFR-3 to VEGF-C, and (ii) identifying as a modulator a test compound which alters VEGFR-3 binding to VEGF-C and which binds VEGF-C at a site defined by Thr' 4 8 Asn' 4 9 Thr' 10 Phe" 51 and Pro' s of SEQ ID NO: 22, or which binds VEGFR-3 at VEGFR-3 residues which interface with said residues of SEQ ID NO: 22.
Also contemplated as aspects of the invention are compositions that comprise modulators identified by the foregoing methods, especially compositions comprising substantially purified modulators in a pharmaceutically acceptable carrier. Similarly, use of such modulators in the manufacture of a medicament for the treatment of disease states characterized by abnormal vascular endothelial growth factor receptor activity is contemplated.
In still another variation, any of the foregoing methods optionally include the additional step of administering the identified modulator to a patient in need of treatment for a disease state characterized by undesirable levels of receptor activity; or -46- I a step of contacting cells that express the receptor to modulate the level of receptor O activity in the cells.
In a further embodiment, the invention includes a method to ameliorate a pathology
O
Z arising from VEGFR-1 binding to a natural ligand that binds VEGFR-I comprising the step of administering to an individual in need thereof an inhibitor of VEGFR-1 binding to the ligand in an amount effective to inhibit VEGFR-I binding to the ligand, said inhibitor binding to an VEGFR-1 regulatory site selected from the group consisting of a site defined by Phe 43 Met 44 Tyr 47 Gn 48 Tyr 5 1 Gin' 0 s and Met 0 7 ofSEQ ID NO: 2 and a site defined e¢ by Lys 42 Phe 43 Met 44 Tyr 47 Gin 48 Tyr s 5 Ile 72 Lys 74 Asp 89 Gly 9 1 Leu 92 Gln l os Met 1 7 Ile 09 Phe' His"2, Gin" 5 Ile"', Glu129, Arg 3 and Pro 32 of SEQ ID NO: 2. Similarly, the invention includes a method to ameliorate a pathology arising from VEGFR-3 binding to a natural ligand that binds VEGFR-3 comprising the step of administering to an individual in need thereof an inhibitor of VEGFR-3 binding to the ligand in an amount effective to inhibit VEGFR-3 binding to the ligand, said inhibitor binding to an VEGFR-3 regulatory site selected from the group consisting of a site defined by Lys 20 Ser' 21 le' 2 Trp 26 Arg 1 27 Gin 1 3 0 Phe 1 51 Lys 53 Ser 1 68 Gly 1 7 0 Leu 71 Tyr' 84 Phe 18 6 Ile 1 9 Pro' 91 Pro 1 96 Pro 1 98 Arg 21 0 Met 2 12 and Ser 213 ofSEQ ID NO: 22 and a site defined by Thr 48 Asn 1 49 Thr" 1 Phe' 51 and Pro"' of SEQ ID NO: 22.
In yet further embodiments, the invention includes a polypeptide comprising an amino acid sequence at least 95% identical to an amino acid sequence selected from the group consisting of: amino acids 1-102 of SEQ ID NO: 51; amino acids 1-102 of SEQ ID NO: 63; amino acids 1-104 of SEQ ID NO: 71; amino acids 1-104 of SEQ ID NO: 153; amino acids 1-103 of SEQ ID NO: 161; amino acids 1-102 of SEQ ID NO: 163; amino acids 1-104 of SEQ ID NO: 165; amino acids 1-104 of SEQ ID NO: 167; amino acids 1- 104 of SEQ ID NO: 173; and amino acids 1-104 of SEQ ID NO: 175, wherein the polypeptide binds human vascular endothelial growth factor receptors VEGFR-1, VEGFR- 2, and VEGFR-3. In still further embodiments, the invention includes a polypeptide comprising an amino acid sequence selected from the group consisting of: amino acids 1- 102 of SEQ ID NO: 51; amino acids 1-102 of SEQ ID NO: 63; amino acids 1-104 of SEQ ID NO: 71; amino acids 1-104 of SEQ ID NO: 153; amino acids 1-103 of SEQ ID NO: 161; amino acids 1-102 of SEQ ID NO: 163; amino acids 1-104 of SEQ ID NO: 165; -46A- IND amino acids 1-104 of SEQ ID NO: 167; amino acids 1-104 of SEQ ID NO: 173; and amino acids 1-104 of SEQ ID NO: 175.
Additional embodiments, features, and variations of the invention will be 0 z apparent to those skilled in the art from the entirety of this application, including the s Drawing and the Detailed Description, and all such features are intended as aspects of the invention.
t" Likewise, features of the invention described herein can be re-combined into additional embodiments that also are intended as aspects of the invention, irrespective of Swhether the combination of features is specifically mentioned above as an aspect or IN 10 embodiment of the invention. Also, only such limitations which are described herein as Scritical to the invention should be viewed as such; variations of the invention lacking limitations which have not been described herein as critical are intended as aspects of the invention.
With respect to aspects of the invention that have been described as a set or genus, every individual member of the set or genus is intended, individually, as an aspect of the invention.
In addition to the foregoing, the invention includes, as an additional aspect, all embodiments of the invention narrower in scope in any way than the variations specifically mentioned above. Although the applicant(s) invented the full scope of the claims appended hereto, the claims appended hereto are not intended to encompass within their scope the prior art work of others. Therefore, in the event that statutory prior art within the scope of a claim is brought to the attention of the applicants by a Patent Office or other entity or individual, the applicant(s) reserve the right to exercise amendment rights under applicable patent laws to redefine the subject matter of such a claim to specifically exclude such statutory prior art or obvious variations of statutory prior art from the scope of such a claim. Variations of the invention defined by such amended claims also are intended as aspects of the invention.
BRIEF DESCRIPTION OF THE DRAWING Figure 1 depicts a perspective view of a three-dimensional model of a VEGF-A monomer, in which selected secondary structure elements are identified. A VEGF-
NO
S-47- A-encoding polynucleotide was divided into nine segments for construction of VEGF- Z A/VEGF-C chimeras, and labels 1-9 identify the location of the peptides encoded by 0 each of the iine segments.
Figure 2 is a schematic diagram of the 9 VEGF-A and 9 VEGF-C DNA It 5 fragments used to construct the VEGF-A/VEGF-C hybrid molecules. These fragments are numbered 1 through 9 on top. The N123, N45, C67 and C89 groups of fragments are also indicated. N123 consists of 3 VEGF-A fragments and 3 VEGF-C O fragments (fragments whereas N45 (fragments C67 (fragments and C89 (fragments 8-9) each consist of 2 VEGP-A fragments and 2 VEGF-C fragments.
Selected restriction endonuclease sites also are depicted.
Figure 3 schematically depicts all 8 possible DNA molecules corresponding to the N123 region, resulting from ligating different combinations of fragments 1,2, and 3 from VEGF-A (Al, A2, and A3) and VEGF-C (Cl, C2, and C3).
Figure 4 schematically depicts all 4 possible DNA molecules corresponding to the N45 region resulting from ligating different combinations of fragments 4 and from VEGF-A and VEGF-C.
Figure 5 schematically depicts all 4 possible DNA molecules colTesponding to the C67 region resulting from ligating different combinations of fragments 6 and 7 from VEGF-A and VEGF-C.
Figure 6 schematically depicts all 4 possible DNA molecules corresponding to the C89 region resulting from ligating different combinations of fragments 8 and 9 from VEGF-A and VEGF-C.
Figures 7A-7D depict in boxes the amino acid sequences encoded by DNA fragments A1-A9 (SEQ ID NOs: 128 136) and C1-C9 (SEQ ID NOs: 137 145), and depict the manner in which longer encoded amino acid sequences were formed through the joining of fragments AI-A3 and C1-C3 in the N123 ligation (Fig 7A); of fragments A4-A5 and C4-C5 in the N45 ligation (Fig. 7B); of fragments A6-A7 and C6-C7 in the C67 ligation; and of fragments A8-A9 and C8-C9 in the C89 ligation.
In each figure, arrows represent peptide bonds between encoded amino acid sequences that result from proper ligation of compatible DNA fragments and translation of the resultant ligated DNA.
ND
-48- Figure 8 is a three-dimensional model showing the interaction ofa VEGF-A O dimer with two VEGFR-1 molecules. Residues within the VEGF-A monomers important for interfacing with VEGFR-1 are clustered at the two ends of the VEGF-A dimer and include the N-terminal helix and part of the P5 strand.
Figure 9 is a three-dimensional model depicting the groove formed by a VEGF-C dimer. The entry and the sides of this groove are formed by the fragments, V described in Example 4, that appear to be important for conferring VEGFR-3 C"l specificity.
I
SFigure 10 is a three-dimensional model of a the interaction between a VEGF-C CI 10 dimer and a single VEGFR-3 molecule, extrapolated from the VEGF-A/VEGFR-A model.
DETAILED DESCRIPTION The present invention provides novel polypeptides that bind cellular receptors for vascular endothelial growth factor polypeptides; polynucleotides encoding such polypeptides; compositions comprising the polypeptides and polynucleotides; and methods and uses involving the foregoing. These materials and methods are described in detail in the preceding Summary of Invention section, which is hereby incorporated into the Detailed Description in its entirety. Some polypeptides of the invention exhibit unique receptor binding profiles compared to known, naturally occurring vascular endothelial growth factors.
Methods of Making Peptides The peptides of the present invention may be synthesized using a variety of methods, including those described in the summary of invention and the examples.
The peptides of the present invention can be synthesized in solution or on a solid support in accordance with conventional techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. See, for example, Stewart and Young, Solid Phase Peptide Synthesis, 2d. ed., Pierce Chemical Co., (1984);Tam et al., J Am. Chem. Soc., 105:6442, (1983); Merrifield, Science, 232: 341-347, (1986); and Barany and Merrifield, The Peptides, Gross and
IO
0-49- Meienhofer, eds, Academic Press, New York, 1-284; Barany et al., Int. J Peptide
O
Z Protein Res., 30, 705-739 (1987); and U.S. Pat. No. 5,424,398), each incorporated Sherein by reference.
Solid phase peptide synthesis methods use a copoly(styrene-divinylbenzene) containing 0.1-1.0 mMol amines/g polymer. These methods for peptide synthesis use butyloxycarbonyl (t-BOC) or 9-fluorenylmethyloxy-carbonyl(FMOC) protection of c alpha-amino groups. Both methods involve stepwise syntheses whereby a single amino acid is added at each step starting from the C-terminus of the peptide (See, 0 Coligan, et al., Current Protocols in nImunology, Wiley Interscience, 1991, Unit 9)
C
l 10 On completion of chemical synthesis, the peptides can be deprotected to remove the tt-BOC or FMOC amino acid blocking groups and cleaved from the polymer by treatment with acid at reduced temperature liquid HF-10% anisole for about 0.25 to about 1 hours at After evaporation of the reagents, the peptides are extracted from the polymer with 1% acetic acid solution which is then lyophilized to yield the crude material. This can nonnally be purified by such techniques as gel filtration on Sephadex G-15 using 5% acetic acid as a solvent. Lyophilization of appropriate fractions of the column will yield the homogeneous peptide or peptide derivatives, which can then be characterized by such standard techniques as amino acid analysis, thin layer chromatography, high performance liquid chromatography, ultraviolet absorption spectroscopy, molar rotation, solubility, and quantitated by the solid phase Edman degradation.
Other methods, such as selecting peptides from a phage display library, are available for improving upon peptide specifically described herein. Libraries can be prepared from sets of amino acids as described herein. Phage display can be particularly effective in identifying binding peptides useful according to the invention.
Briefly, one prepares a phage library (using e.g. ml 13, fd, or lambda phage), displaying inserts from 4 to about 80 amino acid residues. The inserts may represent, for example, a completely degenerate or biased array. One then can select phagebearing inserts which bind to the target VEGF receptor(s). This process can be repeated through several cycles ofreselection of phage that bind to the target receptor(s). Repeated rounds lead to enrichment of phage bearing particular
IO
sequences. DNA sequence analysis can be conducted to identify the sequences of the 0 expressed polypeptides. The minimal linear portion of the sequence that binds to the target receptor(s) can be determined. One can repeat the procedure using a biased library containing inserts containing part or all of the minimal linear portion plus one or more additional degenerate residues upstream or downstream thereof. These techniques may identify peptides of the invention with still greater receptor binding n) affinity than peptides already identified herein. Screening resultant peptide against CK, multiple receptors will identify peptides with multiple receptor binding affinities.
ID
SYeast two-hybrid screening methods also may be used to identify polypeptides that C 10 bind to the target receptor(s).
Alternatively, a variety of expression vector/host systems may be utilized to contain and express the chimeric peptides of the present invention. These include but are not limited to microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors baculovinis); plant cell systems transfected with virus expression vectors cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMVV) or transformed with bacterial expression vectors Ti or pBR322 plasmid); or animal cell systems.
Mammalian cells that are useful in recombinant protein productions include but are not limited to VERO cells, HeLa cells, Chinese hamster ovary (CHO) cell lines, COS cells (such as COS-7), W138, BHK, HepG2, 3T3, RIN, MDCK, A549, PC12, K(562 and 293 cells. Exemplary protocols for the recombinant expression of the protein are described herein below.
For example, the chimeric peptide may be recombinantly expressed in yeast using a commercially available expression system, the Pichia Expression System (Invitrogen, San Diego, CA), following the manufacturer's instructions. This system also relies on the pre-pro-alpha sequence to direct secretion, but transcription of the insert is driven by the alcohol oxidase (AOX1) promoter upon induction by methanol.
The secreted peptide is purified from the yeast growth medium by, the methods used to purify the chimeric peptide from bacterial and mammalian cell supernatants.
NO
0 -51- Alternatively, the cDNA encoding the peptide may be cloned into the z baculovirus expression vector pVL1393 (PharMingen, San Diego, CA). This vector 0 is then used according to the manufacturer's directions (PharMingen) to infect Spodoptera frugiperda cells in sF9 protein-free media and to produce recombinant protein. The protein is purified and concentrated from the media using a heparin- Sepharosc column (Phannacia, Piscataway, NJ) and sequential molecular sizing columns (Amicon, Beverly, MA), and resuspended in PBS. SDS-PAGE analysis
N
shows a single band and confinns the size of the protein, and Edman sequencing on a SPorton 2090 Peptide Sequencer confinns its N-terminal sequence.
C 10 Alternatively, the peptide may be expressed in an insect system. Insect systems for protein expression are well known to those of skill in the art. In one such system, Autographa califomica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes in Spodoptera frugiperda cells or in Trichoplusia larvae. The peptide coding sequence is cloned into a nonessential region of the virus, such as the polyhedrin gene, and placed under control of the polyhedrin promoter. Successful insertion of the peptide will render the polyhedrin gene inactive and produce recombinant virus lacking coat protein coat. The recombinant viruses are then used to infect S. fiugiperda cells or Trichoplusia larvae in which peptide is expressed (Smith et al., J Virol 46: 584, 1983; Engelhard EK et al., Proc Nat Acad Sci 91: 3224-7, 1994).
In another example, the DNA sequence encoding the peptide is amplified by PCR and cloned into an appropriate vector for example, pGEX-3X (Pharmacia, Piscataway, NJ). The pGEX vector is designed to produce a fusion protein comprising glutathione-S-transferase (GST), encoded by the vector, and a protein encoded by a DNA fragment inserted into the vector's cloning site. The primers for the PCR may be generated to include for example, an appropriate cleavage site.
Where the fusion partner was used solely to facilitate expression or is otherwise not desirable as an attachment to the peptide of interest, the recombinant fusion protein may then be cleaved from the GST portion of the fusion protein. The pGEX-3X/chimeric peptide construct is transformed into E. coli XL-1 Blue cells (Stratagene, La Jolla CA), and individual transformants were isolated and grown.
cN -52- Plasmid DNA from individual transfonnants is purified and partially sequenced using O an automated sequencer to confirm the presence of the desired chimeric peptide encoding nucleic acid insert in the proper orientation.
Particularly preferred peptide compositions of the present invention are those which are conjugated to any anti-tumor peptide such as a tumor necrosis factor (TNF).
In a particularly prefccred method, the TNF-peptides chimeras arc generated as tr recombinant fusions with peptide-encoding sequences fused in frame to TNF M (Novagen) encoding sequences. Peptide-TNF cDNA is cloned into pET-1 lb vector MN (Novagen) and the expression of TNF-peptides in BL21 E. coli is induced according to the pETI lb manufacturer's instruction. Soluble TNF-peptides are purified from bacterial lysates by ammonium sulfate preparation, hydrophobic interaction chromatography on Phenyl-Sepharose 6 Fast Flow, ion exchange chromatography on DEAE-Sepharose Fast Flow and gel filtration chromatography on Sephacryl-S-300
HR.
It is contemplated that recombinant protein production also may be used to produce the chimeric peptide compositions. For example, induction of the GST/chimeric peptide is achieved by growing the transfonned XL-1 Blue culture at 37C in LB medium (supplemented with carbenicillin) to an optical density at wavelength 600 urn of 0.4, followed by further incubation for 4 hours in the presence of 0.5 mM Isopropyl P-D-Thiogalactopyranoside (Sigma Chemical Co., St. Louis
MO).
The fusion protein, expected to be produced as an insoluble inclusion body in the bacteria, may be purified as follows. Cells are harvested by centrifugation; washed in 0.15 M NaC1, 10 mM Tris, pH 8, 1 nmM EDTA; and treated with 0.1 mg/ml lysozyme (Sigma Chemical Co.) for 15 minutes at room temperature. The lysate is cleared by sonication, and cell debris is pelleted by centrifugation for 10 minutes at 12,000 X g. The fusion protein-containing pellet is resuspended in 50 mM Tris, pH 8, and 10 mM EDTA, layered over 50% glycerol, and centrifuged for 30 min. at 6000 X g. The pellet is resuspended in standard phosphate buffered saline solution (PBS) free ofMg' and The fusion protein is further purified by fractionating the resuspended pellet in a denaturing SDS polyacrylamide gel (Sambrook et al., supra).
O(
-53- The gel is soaked in 0.4 M KCI to visualize the protein, which is excised and
O
0 electroeluted in gel-running buffer lacking SDS. If the GST/chimeric peptide fusion protein is produced in bacteria as a soluble protein, it may be purified using the GST Purification Module (Pharmacia Biotech).
The fusion protein may be subjected to digestion to cleave the GST from the chimeric peptide of the invention. The digestion reaction (20-40 ltg fusion protein, n 20-30 units human thrombin (4000 U/mg (Sigma) in 0.5 ml PBS) is incubated 16-48 Cl€ Slihrs. at room temperature and loaded on a denaturing SDS-PAGE gel to fractionate the 0reaction products. The gel is soaked in 0.4 M KCI to visualize the protein bands. The C l 10 identity of the protein band corresponding to the expected molecular weight of chimeric peptide may be confirmed by amino acid sequence analysis using an automated sequencer (Applied Biosystems Model 473A, Foster City, CA).
Alternatively, the identity may be confirmed by performing HPLC and/or mass spectometry of the peptides.
Alternatively, the DNA sequence encoding the chimeric peptide may be cloned into a plasmid containing a desired promoter and, optionally, a leader sequence (see, Better et al., Science, 240:1041-43, 1988). The sequence of this construct may be confirmed by automated sequencing. The plasmid is then transformed into E.
coli strain MC1061 using standard procedures employing CaCI, incubation and heat shock treatment of the bacteria (Sambrook et al., supra). The transformed bacteria are grown in LB medium supplemented with carbenicillin, and production of the expressed protein is induced by growth in a suitable medium. If present, the leader sequence will effect secretion of the chimeric peptide and be cleaved during secretion.
The secreted recombinant protein is purified from the bacterial culture media by the method described herein below.
Mammalian host systems for the expression of the recombinant protein also are well known to those of skill in the art. Host cell strains may be chosen for a particular ability to process the expressed protein or produce certain post-translation modifications that will be useful in providing protein activity. Such modifications of the polypeptide include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation and acylation. Different host cells such as
O
O -54- CFIO, IeLa, MDCK, 293, WI38, and the like have specific cellular machinery and 0 characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the introduced, foreign protein.
It is preferable that the transformed cells are used for long-termn, high-yield protein production and as such stable expression is desirable. Once such cells are transformed with vectors that contain selectable markers along with the desired iy expression cassette, the cells may be allowed to grow for 1-2 days in an enriched Smedia before they are switched to selective media. The selectable marker is designed to confer resistance to selection and its presence allows growth and recovery of cells that successfully express the introduced sequences. Resistant clumps of stably transformed cells can be proliferated using tissue culture techniques appropriate to the cell.
A number of selection systems may be used to recover the cells that have been transformed for recombinant protein production. Such selection systems include, but are not limited to, HSV thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes, in tk-, hgprtor aprt- cells, respectively. Also, anti-netabolite resistance can be used as the basis of selection for dhfr, that confers resistance to methotrexate; gpt, that confers resistance to mycophenolic acid; neo, that confers resistance to the aminoglycoside G418; also that confers resistance to chlorsulfuron; and hygro, that confers resistance to hygromycin. Additional selectable genes that may be useful include trpB, which allows cells to utilize indole in place oftryptophan, or hisD, which allows cells to utilize histinol in place ofhistidine. Markers that give a visual indication for identification of transformants include anthocyanins, beta-glucuronidase and its substrate, GUS, and luciferase and its substrate, luciferin.
For certain applications, it may be desirable to produce peptides or polypeptides of the present invention which are resistant to proteolytic digestion.
Such peptides may include non-hydrolyzable peptide bonds, and peptides having end modifications such as an amide CONH2) at the C-terminus or a acetyl group at the N-terminus. It is contemplated that the peptides of the invention are modified
-SS-
such that their in vivo half life is increased, their physical stability is increased, rate of 0 in vivo release and rate of in vivo clearance also may be affected.
To prepare non-hydrolyzable peptides, one may select peptides from a library non-hydrolyzable peptides, or introduce modifications to select peptides, such as one or more D-amino acids or one or more non-hydrolyzable peptide bonds linking amino acids. For example, one can select peptides having a desired receptor binding profile and then modify such peptides as necessary to reduce the potential for hydrolysis by Cl proteases. For example, to determine the susceptibility to proteolytic cleavage, Speptides may be labeled and incubated with cell extracts or purified proteases and C 10 then isolated to determine which peptide bonds are susceptible to proteolysis, by sequencing peptides and proteolytic fragments. Alternatively, potentially susceptible peptide bonds can be identified by comparing the amino acid sequence of the peptides of the present invention with the known cleavage site specificity of a panel of proteases. Based on the results of such assays, individual peptide bonds which are susceptible to proteolysis can be replaced with non-hydrolyzable peptide bonds by in vitro synthesis of the peptide.
Many non-hydrolyzable peptide bonds are known in the art, along with procedures for synthesis of peptides containing such bonds. Non-hydrolyzable bonds include [CH 2 reduced amide peptide bonds, [COCH 2 ketomethylene peptide bonds, [CH(CN)NH]-- (cyanomethylene)amino peptide bonds, [CH 2 hydroxyethylene peptide bonds, peptide bonds, and [CH, S]thiomethylene peptide bonds (see U.S. Patent 6,172,043).
Peptides useful in the invention can be linear, or maybe circular or cyclized by natural or synthetic means. For example, disulfide bonds between cysteine residues may cyclize a peptide sequence. Bifunctional reagents can be used to provide a linkage between two or more amino acids of a peptide. Other methods for cyclization ofpeptides, such as those described by Anwer et al. (Int. J Pep. Protein Res. 36:392- 399, 1990) and Rivera--Baeza et al. (Neuropeptides 30:327-333, 1996) are also known in the art.
Furthermore, nonpeptide analogs of peptides which provide a stabilized structure or lessened biodegradation, are also contemplated. Peptide mimetic analogs can be prepared based on a selected peptide by replacement of one or more residues by nonpeptide moieties. Preferably, the nonpeptide moieties permit the peptide to retain its natural confirmation, or stabilize a preferred, bioactive, confirmation.
One example of methods for preparation of nonpeptide mimetic analogs from peptides is described in Nachman et al., Regul. Pept. 57:359-370 (1995). Peptide as used herein embraces all of the foregoing.
The polypeptides of the invention include polypeptides that are modified, for instance, by glycosylation, amidation, carboxylation, or phosphorylation, or by the creation of acid addition salts, amides, esters, in particular C-terminal esters, and Nacyl derivatives.
Also, as described above, the invention embraces polypeptides modified by forming covalent or noncovalent complexes with other moieties. Covalently-bound complexes can be prepared by linking the chemical moieties to functional groups on the side chains of amino acids comprising the peptides, or at the N- or C-temlinus.
In particular, it is anticipated that the aforementioned peptides can be conjugated to a reporter group, including, but not limited to a radiolabel, a fluorescent label, an enzyme that catalyzes a colorimetric or fluorometric reaction), a substrate, a solid matrix, or a carrier biotin or avidin). The invention accordingly provides a molecule comprising a chimeric polypeptide comprising a plurality of peptide subunits derived from two or more vascular endothelial growth factor polypeptides, wherein the chimeric polypepitde preferably further comprises a reporter group selected from the group consisting of a radiolabel, a fluorescent label, an enzyme, a substrate, a solid matrix, and a carrier. The use of such labels is well known and is described in, U.S. No. Patent 3,817,837; U.S. Patent No.
3,850,752; U.S. Patent No. 3,996,345 and U.S. Patent No. 4,277,437. Other labels that will be useful include but are not limited to radioactive labels, fluorescent labels and chemiluminescent labels. U.S. Patents concerning use of such labels include for example U.S. Patent No. 3,817,837; U.S. Patent No. 3,850,752; U.S. Patent No.
3,939,350 and U.S. Patent No. 3,996,345. Any of the peptides of the present invention may comprise one, two, or more of any of these labels.
O
-57- Methods of Using the Polypeptides of the Invention 0 Z The many biological activities mediated through the PDGF/VEGF receptor 0 family (including but not limited to affecting growth and migration of vascular endothelial cells and blood vessels; promoting growth of lymphatic endothelial cells and lymphatic vessels; increasing vascular permeability; and affecting myelopoiesis) support numerous diagnostic and in vitro and in viva clinical utilities for polypeptides Sof the invention that are capable of binding one of more members of the VEGF Sreceptor fanily, for modulating (stimulating or inhibiting) these biological activities.
0 Multiple mechanisms exist through which polypeptides of the invention will C 10 act as growth factors agonmsts or receptor stimulants). For example, polypeptides of the invention that form homodimers that bind and activate one or more members of the VEGF receptor family will be useful as vascular endothelial growth factors.
Alternatively, polypeptides of the invention that fonn heterodimers with endogenous growth factor polypeptides (VEGF-A or VEGF-C or other family members) will also be effective agonists, provided that the heterodimers so formed are capable of binding and activating receptors to induce signal transduction.
Multiple mechanisms exist through which polypeptides of the invention will act as inhibitors (antagonists) of growth factors of the VEGF family. Polypeptides of the invention that bind but fail to stimulate one or more receptors will inhibit stimulation of the receptor by endogenous growth factor, thereby acting as an inhibitor of endogenous growth factor. Such failure to stimulate may be due, in whole or in part, to an inability to dimerize the receptor, perhaps due to an inability of the hybrid polypeptide of the invention to form growth factor homodimers. Polypeptides of the invention that form heterodimers with endogenous growth factor polypeptides will inhibit stimulation of VEGF receptors if the heterodimer fails to bind receptors, or if the heterodimer binds only to an individual receptor or a heterologous receptor pair in a manner that prevents receptor activation and signal transduction. Whichever the mechanism, polypeptides of the invention that form activity-destroying heterodimers with endogenous VEGF polypeptides (and that do not form active homodimers) are useful as antagonists of natural endogenous VEGF activity. Also, any polypeptide that binds a receptor can be conjugated to a cytotoxic or cytostotic agent in order to
O
-58deliver such agents to target cells. The attachment of such agent is another means for O inhibiting growth of cells in which VEGF polypeptides exhibit a mitogenic response.
SExemplary toxins include chemotherapeutic, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc.
It also will be apparent that two or more hybrid polypeptides of the invention can be mixed, and that heterodimers so formed will be useful as modulators l depending upon their receptor binding and stimulating properties. Because Cl polypeptides of the invention are hybrids derived from naturally-occuring vascular I endothelial growth factors that may have different receptor binding profiles, it is contemplated that some of the hybrids will act as activators of one or more receptors, and some will act as inhibitors of one or more receptors. Procedures described herein and other procedures known in the art can be used to determine receptor binding, receptor activation, and receptor inhibition properties of polypeptides of the invention.
The polypeptides of the invention that bind and activate one or more VEGF receptors may be useful for promoting angiogenesis and/or lymphangiogenesis, for example, to promote wound healing, to facilitate tissue transplantation, and to promote the formation of collateral vessels around arterial stenoses, and into injured tissues after infarction, to treat ischemia. On the other hand, polypeptides of the invention that behave as antagonists of endogenous VEGF proteins can be used in therapeutic applications to treat diseases such as neoplasias, retinopathy, rheumatoid arthritis, and psoriasis, in which suppression of angiogenesis is desirable.
Polypeptides of the present invention differ from natural VEGF receptor ligands in that some of them selectively bind one of the VEGF receptors and can thus be used to specifically induce signaling through one particular VEGF receptor. For example, polypeptides that solely induce VEGFR-3 signaling can be used therapeutically to target the lymphatic endothelia of individuals affected with lymphatic disorders, to improve the structure and function of the lymphatic vasculature of such individuals. Such polypeptides also can be used to target neoplasia characterized by cells expressing VEGFR-3 on their surfaces. Chemotaxis of monocytes/macrophages [Barleon et al., Blood 87:3336-3343 (1996)] due to VEGFs is mediated by VEGFR-1. Thus, molecules that specifically target the VEGFR-1 receptor can be used to direct therapeutic effects on this particular VEGF 0 z receptor. For example, inhibitors of VEGFR-1 may be used to prevent virally induced angiogenesis, and molecules that specifically activate VEGFR-I can be used to enhance monocyte/macrophage migration. VEGFR-2 is essential for angiogenesis and sufficient for virally-induced angiogenesis. Thus, inhibitors of VEGFR-2 may be used for inhibiting angiogenesis, including that induced by viral VEGFs., whereas t molecules that stimulate VEGFR-2 can be useful for promoting angiogenesis.
CK A subset of the polypeptides of the present invention can bind combinations of 0 VEGF receptors not demonstrated for known natural VEGF ligands, or are able to C 10 bind all three known VEGF receptors VEGFR-1, R-2, and R-3. These polypeptides may be useful for therapies in which the activation or inhibition of different combinations of VEGF receptors is desired.
Polypeptides of the invention that can activate VEGFR-3 can be used to promote the endothelial functions of lymphatic vessels and tissues such as to treat loss of lymphatic vessels, occlusions of lymphatic vessels, lymphangiomas, and primary idiopathic lymphedemas, including Milroy's disease and lyrnphedema praecox, as well as secondary lymphedemas, including those resulting from removal of lymph nodes and vessels, radiotherapy and surgery in treatment of cancer, trauma and infection. Polynucleotides or polypeptides of the invention could be administered purely as a prophylactic treatment to prevent lymphedema in subjects at risk for developing lymphedema, or as a therapeutic treatment to subjects afflicted with lymphedema, for the purpose of ameliorating its symptoms swelling due to the accumulation of lymph).
The polynucleotides and polypeptides of the invention that activate VEGFR-3 can also be used to promote re-growth or permeability of lymphatic vessels in patients whose axillary lymphatic vessels were removed during surgical interventions in the treatment of cancer breast cancer). Polynucleotides and polypeptides of the invention can be used to treat vascularization in, for example, organ transplant patients. A composition containing the polypeptide(s) of the invention may be directly applied to the isolated vessel segment prior to its being grafted in vivo to minimize rejection of the transplanted material and to stimulate vascularization of the y transplanted materials.
Polypeptides of the invention that activate VEGF receptor activity may be used to treat wounds, surgical incisions, sores, and other indications where healing is reasonably expected to be promoted if the process ofneovascularization can be induced and/or accelerated.
n As explained in greater detail above and reported in the literature, the ecn N expression of receptors for vascular endothelial growth factors have been observed in
NO
0certain progenitor cells, such as hematopoietic progenitor cells, and VEGF-C has been K 10 observed to have myelopoietic activity. These observations provide an indication that polynucleotides or polypeptides according to the invention may be used to treat or prevent inflammation, infection, or immune disorders by modulating the proliferation, differentiation and maturation, or migration of immune cells or hematopoietic cells.
Polynucleotides or polypeptides according to the invention may also be useful to promote or inhibit trafficking of leukocytes between tissues and lymphatic vessels and migration in and out of the thymus.
Polynucleotides and polypeptides of the invention can be used for stimulating myelopoiesis (especially growth of neutrophilic granuloctyes) or inhibiting it. Thus, the invention includes a method for modulating myelopoiesis in a mammalian subject comprising administering to a mammalian subject in need of modulation of myelopoiesis an amount of a polypeptide of the invention that is effective to modulate myelopoiesis. In one embodiment, a mammalian subject suffering from granulocytopenia is selected, and the method comprises administering to the subject an amount of a polypeptide effective to stimulate myelopoiesis. In particular, a polypeptide of the invention is administered in an amount effective to increase the neutrophil count in blood of the subject.
In a related embodiment, the invention includes a method of increasing the number of neutrophils in the blood of a mammalian subject comprising the step of expressing in a cell in a subject in need of an increased number of blood neutrophils a DNA encoding a polynucleotide of the invention that is able to activate signaling through VEGF receptors, the DNA operatively linked to a promoter or other control
NO
S-61sequence that promotes expression of the DNA in the cell. Similarly, the invention 0 z includes a method of modulating the growth ofneutrophilic granulocytes in vitro or in 0vivo comprising the step of contacting mammalian stem cells with a polypeptide of the invention in an amount effective to modulate the growth of mammalian enlothelial cells.
The invention also includes a method for modulating the growth of CD34+ progenitor cells (especially hematopoietic progenitor cells and endothelial progenitor C' cells) in vitro or in vivo comprising the step of contacting mammalian CD34+ Sprogenitor cells with a polypeptide of the invention in an amount effective to C 10 modulate the growth of mammalian endothelial cells. For in vitro methods, CD34+ progenitor cells isolated from cord blood or bone marrow are specifically contemplated. In vitro and in vivo methods of the invention for stimulating the growth of CD34+ precursor cells also include methods wherein polypeptides of the invention are employed together (simultaneously or sequentially) with other polypeptide factors for the purpose of modulating hematopoiesis/myelopoiesis or endothelial cell proliferation. Such other factors include, but are not limited to colony stimulating factors ("CSFs," granulocyte-CSF (G-CSF), macrophage-CSF (M- CSF), and granulocyte-macrophage-CSF (GM-CSF)), interleukin-3 (IL-3, also called multi-colony stimulating factor), other interleukins, stem cell factor (SCF), other polypeptide factors, and their analogs that have been described and are known in the art. See generally The Cytoline Handbook, Second Ed., Angus Thomson (editor), Academic Press (1996); Callard and Gearing, The Cytokine FactsBook, Academic Press Inc. (1994); and Cowling and Dexter, TIBTECH, 10(10):349-357 (1992). The use of a polypeptide of the invention as a progenitor cell or myelopoietic cell growth factor or co-factor with one or more of the foregoing factors may potentiate previously unattainable myelopoietic effects and/or potentiate previously attainable myelopoietic effects while using less of the foregoing factors than would be necessary in the absence of a polypeptide of the invention.
Polynucleotides and polypeptides of the invention may also be used in the treatment of lung disorders to improve blood circulation in the lung and/or gaseous exchange between the lungs and the blood stream; to improve blood circulation to the
IO
S-62heart and 0, gas permeability in cases of cardiac insufficiency; to improve blood flow O and gaseous exchange in chronic obstructive airway disease; and to treat conditions O such as congestive heart failure, involving accumulations of fluid in, for example, the lung resulting from increases in vascular permeability, by exerting an offsetting effect on vascular permeability in order to counteract the fluid accumulation.
Polynucleotides and polypeptides of the invention could be used to treat i malabsorptive syndromes in the intestinal tract as a result of its blood circulation Ce¢ increasing and vascular permeability increasing activities.
Polypeptides of the invention that bind but do not stimulate signaling through one or more of the VEGF receptors may be used to treat chronic inflammation caused by increased vascular permeability, retinopathy associated with diabetes, rheumatoid arthritis and psoriasis.
Polynucelotides or polypeptides according to the invention that are able to inhibit the function of one or more VEGF receptors can also be used to treat edema, peripheral arterial disease, Kaposi's sarcoma, or abnormal retinal development in premature newborns.
In another embodiment, the invention provides a method for modulating the growth of endothelial cells in a mammalian subject comprising the steps of exposing mammalian endothelial cells to a polypeptide according to the invention in an amount effective to modulate the growth of the mammalian endothelial cells. In one embodiment, the modulation of growth is affected by using a polypeptide capable of stimulating tyrosine phosphorylation of VEGF receptors in a host cell expressing the VEGF receptors. In modulating the growth of endothelial cells, the invention contemplates the modulation of endothelial cell-related disorders. In a preferred embodiment, the subject, and endothelial cells, are human. The endothelial cells may be provided in vitro or in vivo, and they may be contained in a tissue graft. An effective amount of a polypeptide is an amount necessary to achieve a reproducible change in cell growth rate (as detennined by microscopic or macroscopic visualization and estimation of cell doubling time, or nucleic acid synthesis assays).
Since angiogenesis and neovascularization are essential for tumor growth, inhibition of angiogenic activity can prevent further growth and even lead to
O
-63regression of solid tumors. Likewise inhibition of lymphangrogenesis may be 0 instrumental in preventing metastases. Polynucleotides and polypeptides of the invention may be useful to treat neoplasias including sarcomas, melanomas, carcinomas, and gliomas by inhibiting tumor angiogenesis.
Thus, it is contemplated that a wide variety of cancers may be treated using the peptides of the present invention including cancers of the brain (glioblastoma, V) astrocytoma, oligodendroglioma, ependymomas), lung, liver, spleen, kidney, lymph C node, pancreas, small intestine, blood cells, colon, stomach, breast, endometrium, Sprostate, testicle, ovary, skin, head and neck, esophagus, bone marrow, blood or C' 10 other tissue.
In many contexts, it is not necessary that the tumor cell be killed or induced to undergo normal cell death or "apoptosis." Rather, to accomplish a meaningful treatment, all that is required is that the tumor growth be slowed to some degree or localized to a specific area and inhibited from spread to disparate sites. It may be that the tumor growth is completely blocked, however, or that some tumor regression is achieved. Clinical terminology such as "remission" and "reduction of tumor" burden also are contemplated given their normal usage. In the context of the present invention, the therapeutic effect may result from an inhibition of angiogenesis and/or an inhibition of lymphangiogenesis.
Thus, the invention includes a method of treating a mammalian organism suffering from a neoplastic disease characterized by expression of one or more VEGF receptor(s) in cells, comprising the steps of: identifying a mammalian organism suffering from a neoplastic disease state characterized by expression of VEGF receptor(s), and administering to the mammalian organism in need of such treatment a composition, the composition comprising one or more polynucleotide(s) or polypeptide(s) of the invention effective to inhibit VEGF receptor-mediated proliferation of the cells. Such treatment methodologies are particularly indicated for neoplastic disease states that are characterized by neovascularization involving vessels lined with endothelial cells that express increased levels of one or more VEGF receptors, relative to endothelial cells lining quiescent vessels; and disease states characterized by a cancer cells that express VEGF receptors. Targeting VEGFR-3 in
ID
O -64tumor imaging and anti-tumor therapy is described in PCT/US99/23525 (WO O 00/21560), published 20 April 2000, incorporated herein by reference. Other VEGF receptors VEGFR-1) also have been implicated in tumor angiogenesis or metastasis.
Evidence exists that at least VEGF-C and VEGF-D of the VEGF family of growth factors have utility for preventing stenosis or restenosis of blood vessels. See n International Patent Application No. PCT/US99/24054 (WO 00/24412), "Use of C VEGF-C or VEGF-D Gene or Protein to Prevent Restenosis," filed October 26, 1999, Sincorporated herein by reference in its entirety. Polypeptides and polynucleotides of 10 the invention also will have utility for these indications. Thus, in another aspect, the invention provides a method of treating a mammalian subject to prevent stenosis or restenosis of a blood vessel, comprising the step of administering to a mammalian subject in need of treatment to prevent stenosis or restenosis of a blood vessel a composition comprising one or more polypeptide(s) of the invention, in an amount effective to prevent stenosis or restenosis of the blood vessel. In a preferred embodiment, the administering comprises implanting an intravascular stent in the mammalian subject, where the stent is coated or impregnated with the composition.
Exemplary materials for constructing a drug-coated or drug-impregnated stent are described in literature cited above and reviewed in Lincoff et al., Circulation, 2070-2084 (1994). In another preferred embodiment, the composition comprises microparticles composed of biodegradable polymers such as PGLA, non-degradable polymers, or biological polymers starch) which particles encapsulate or are impregnated by a polypeptide(s) of the invention. Such particles are delivered to the intravascular wall using, an infusion angioplasty catheter. Other techniques for achieving locally sustained drug delivery are reviewed in Wilensky et al., Trends Caridovasc. Med., 3:163-170 (1993), incorporated herein by reference.
Administration via one or more intravenous injections subsequent to the angioplasty or bypass procedure also is contemplated. Localization of the polypeptides of the invention to the site of the procedure occurs due to expression of VEGF receptors on proliferating endothelial cells. Localization is further facilitated by recombinautly expressing the polypeptides of the invention as a fusion polypeptide
ID
fused to an apolipoprotein B-100 oligopeptide as described in Shih et al., Proc.
z Nat'l. Acad. Sci. USA, 87:1436-1440 (1990). Co-adininistration of polynucleotides and polypeptides of the invention is also contemplated.
Likewise, the invention also provides surgical devices that are used to treat circulatory disorders, such as intravascular or endovascular stents, balloon catheters, infusion-perfusion catheters, extravascular collars, elastomeric membranes, and the Slike, which have been improved by coating with, impregnating with, adhering to, or Cl¢ Sencapsulating within the device a composition comprising a polynucleotide or
NO
Spolypeptide of the invention.
C 10 Polynucleotides or polypeptides of the invention could be administered purely as a prophylactic treatment to prevent stenosis, or shortly before, and/or concurrently with, and/or shortly after a percutaneous transluminal coronary angioplasty procedure, for the purpose of preventing restenosis of the subject vessel. In another preferred embodiment, the polynucleotide or polypeptide is administered before, during, and/or shortly after a bypass procedure a coronary bypass procedure), to prevent stenosis or restenosis in or near the transplanted (grafted) vessel, especially stenosis at the location of the graft itself. In yet another embodiment, the polynucleotide or polypeptide is administered before, during, or after a vascular transplantation in the vascular periphery that has been performed to treat peripheral ischemia or intermittent claudication. By prevention of stenosis or restenosis is meant prophylactic treatment to reduce the amount/severity of, and/or substantially eliminate, the stenosis or restenosis that fi-equently occurs in such surgical procedures. The polynucleotide or polypeptide is included in the composition in an amount and in a form effective to promote stimulation of VEGF receptors in a blood vessel of the mammalian subject, thereby preventing stenosis or restenosis of the blood vessel.
In a preferred embodiment, the mammalian subject is a human subject. For example, the subject is a person suffering from coronary artery disease that has been identified by a cardiologist as a candidate who could benefit from a therapeutic balloon angioplasty (with or without insertion of an intravascular stent) procedure or from a coronary bypass procedure. Practice of methods of the invention in other mammalian subjects, especially mammals that are conventionally used as models for
IND
O
8 66 demonstrating therapeutic efficacy in humans primate, porcine, canine, or rabbit 0 animals), also is contemplated.
Polypeptides according to the mivcntion may be administered in any suitabic manner using an appropriate pharmaccutically-acceptable vehicle, a phaimnaceutically-acceptable diluent, adjuvant, excipient or carrier. The composition to be administered according to methods of the invention preferably comprises (in It" addition to the polynucleotide or vector) a pharmaceutically-acceptable carrier t solution such as water, saline, phosphate-buffered saline, glucose, or other carriers conventionally used to deliver therapeutics intravascularly. Multi-gene therapy is also contemplated, in which case the composition optionally comprises both the polynucleotide of the invention/vector and another polynucleotide/vector selected to prevent restenosis. Exemplary candidate genes/vectors for co-transfection with transgenes encoding polypeptides of the invention are described in the literature cited above, including genes encoding cytotoxic factors, cytostatic factors, endothelial growth factors, and smooth muscle cell growth/migration inhibitors.
The "administering" that is performed according to the present method may be performed using any medically-accepted means for introducing a therapeutic directly or indirectly into the vasculature of a mammalian subject, including but not limited to injections intravenous, intramuscular, subcutaneous, or catheter); oral ingestion; intranasal or topical administration; and the like. In a preferred embodiment, administration of the composition comprising a polynucleotide of the invention is performed intravascularly, such as by intravenous, intra-arterial, or intracoronary arterial injection. The therapeutic composition may be delivered to the patient at multiple sites. The multiple administrations may be rendered simultaneously or may be administered over a period of several hours. In certain cases it may be beneficial to provide a continuous flow of the therapeutic composition. Additional therapy may be administered on a period basis, for example, daily, weekly or monthly.
In general, peroral dosage forms for the therapeutic delivery of peptides is ineffective because in order for such a formulation to the efficacious, the peptide must be protected from the enzymatic environment of the gastrointestinal tract.
(N
O -67- Additionally, the peptide must be formulated such that it is readily absorbed by the 0 epithelial cell barrier in sufficient concentrations to effect a therapeutic outcome.
The peptides of the present invention may be formulated with uptake or absorption enhancers to increase their efficacy. Such enhancer include for example, salicylate, glycocholate/linoleate, glycholate, aprotinin, bacitracin, SDS caprate and the like.
For an additional discussion of oral formulations of peptides for therapeutic t delivery, those of skill in the art are referred to Fix Pharm. Sci., 85(12) 1282- 1285, 1996) and Oliyai and Stella (Ann. Rev. Pharmacol. Toxicol., 32:521-544,
INO
S1993).
C 10 The amounts of peptides in a given dosage will vary according to the size of the individual to whom the therapy is being administered as well as the characteristics of the disorder being treated. In exemplary treatments, it may be necessary to administer about 50mg/day, 75 mg/day, 100mg/day, 150mg/day, 200mg/day, 250 mg/day. These concentrations may be administered as a single dosage form or as multiple doses.
The polypeptides may also be employed in accordance with the present invention by expression of such polypeptide in vivo, which is often referred to as gene therapy. The present invention provides a recombinant DNA vector containing a heterologous segment encoding a polypeptide of the invention that is capable of being inserted into a microorganism or eukaryotic cell and that is capable of expressing the encoded protein.
In a highly preferred embodiment, the composition is administered locally.
Thus, in the context of treating restenosis or stenosis, administration directly to the site of angioplasty or bypass is preferred. For example, the administering comprises a catheter-mediated transfer of the transgene-containing composition into a blood vessel of the mammalian subject, especially into a coronary artery of the mammalian subject.
Exemplary materials and methods for local delivery are reviewed in Lincoffet al., Circulation, 90: 2070-2084 (1994); and Wilensky et al., Trends Cardiovasc. Med., 3:163-170 (1993), both incorporated herein by reference. For example, the composition is administered using infusion-perfusion balloon catheters (preferably mircroporous balloon catheters) such as those that have been described in the
IO
8 -68literature for intracoronary drug infusions. See, U.S. Patent No. 5,713,860 0 (Intravascular Catheter with Infusion Array); U.S. Patent No. 5,087,244; U.S. Patent O No. 5,653,689; and Wolinskyet al., J. Am. Coll. Cardiol., 15: 475-481 (1990) (Wolinsky Infusion Catheter); and Lambert et al., Coron. Artery Dis., 4: 469-475 (1993), all of which are incorporated herein by reference in their entirety. Use of such catheters for site-directed somatic cell gene therapy is described, in Mazur et al., n Texas Heart histitute Journal, 21; 104-111 (1994), incorporated herein by reference.
C hIn an embodiment where the transgene encoding a polypeptide of the invention is 0 administered in an adenovirus vector, the vector is preferably administered in a 10 pharmaceutically acceptable carrier at a titer of 10'-10' viral particles, and more preferably at a titer of 109-10'' viral particles. The adenoviral vector composition preferably is infused over a period of 15 seconds to 30 minutes, more preferably I to minutes.
For example, in patients with angina pectoris due to a single or multiple lesions in coronary arteries and for whom PTCA is prescribed on the basis of primary coronary angiogram findings,.an exemplary protocol involves performing PTCA through a 7F guiding catheter according to standard clinical practice using the femoral approach. If an optimal result is not achieved with PTCA alone, then an endovascular stent also is implanted. (A nonoptimal result is defined as residual stenosis of 30 of the luminal diameter according to a visual estimate, and B or C type dissection.) Arterial gene transfer at the site of balloon dilatation is performed with a replicationdeficient adenoviral vector expressing a polypeptide of the invention immediately after the angioplasty, but before stent implantation, using an infusion-perfusion balloon catheter. The size of the catheter will be selected to match the diameter of the artery as measured from the angiogram, varying, from 3.0 to 3.5F in diameter.
The balloon is inflated to the optimal pressure and gene transfer is performed during a minute infusion at the rate of 0.5 ml/min with virus titer of 1.15 X 1010.
In another embodiment, intravascular administration with a gel-coated catheter is contemplated, as has been described in the literature to introduce other transgenes.
See, U.S. Patent No. 5,674,192 (Catheter coated with tenaciously-adhered swellable hydrogel polymer); Riessen et al., Human Gene Therapy, 4: 749-758
O
-69- (1993); and Steg et al., Circulation, 96: 408-411 (1997) and 90: 1648-1656 (1994); all 0 incorporated herein by reference. Briefly, DNA in solution a polynucleotide of the invention) is applied one or more times ex vivo to the surface of an inflated angioplasty catheter balloon coated with a hydrogel polymer Slider with Hydroplus, Mansfield Boston Scientific Corp., Watertown, MA). The Hydroplus coating is a hydrophilic polyacrylic acid polymer that is cross-luiked to the balloon to V) form a high molecular weight hydrogel tightly adhered to the balloon. The DNA covered hydrogel is permitted to dry before deflating the balloon. Re-inflation of the
I
0 balloon intravascularly, during an angioplasty procedure, causes the transfer of the N1 10 DNA to the vessel wall.
In yet another embodiment, an expandable elastic membrane or similar structure mounted to or integral with a balloon angioplasty catheter or stent is employed to deliver the transgene encoding a polypeptide of the invention. See, e.g., U.S. Patent Nos. 5,707,385, 5,697,967, 5,700,286, 5,800,507, and 5,776,184, all incorporated by reference herein.
In another variation, the composition containing the transgene encoding a polypeptide of the invention is administered extravascularly, using a device to surround or encapsulate a portion of vessel. See, International Patent Publication WO 98/20027, incorporated herein by reference, describing a collar that is placed around the outside of an artery during a bypass procedure) to deliver a transgene to the arterial wall via a plasmid or liposome vector.
In still another variation, endothelial cells or endothelial progenitor cells are transfected ex vivo with the (ransgene encoding a polypeptide of the invention, and the transfected cells as administered to the mammalian subject. Exemplary procedures for seeding a vascular graft with genetically modified endothelial cells are described in U.S. Patent No. 5,785,965, incorporated herein by reference.
In preferred embodiments, polynucleotides of the invention further comprises additional sequences to facilitate the gene therapy. In one embodiment, a "naked" transgene encoding a polypeptide of the invention a transgene without a viral, liposomal, or other vector to facilitate transfection) is employed for gene therapy. In this embodiment, the polynucleotide of the invention preferably comprises a suitable
ID
O promoter and/or enhancer sequence cytomegalovirus promoter/enhancer [Lehner 0 et al., J. Clin. Microbiol., 29:2494-2502 (1991); Boshart et al., Cell, 41:521-530 (1985)]; Rous sarcoma virus promoter [Davis ct al., Hum. Gene Ther., 4:151 (1993)]; Tie promoter [Korhonen et al., Blood, 86(5): 1828-1835 (1995)]; or simian virus promoter) for expression in the target mammnalian cells, the promoter being operatively linked upstream of the polypeptide-coding sequence. The polynucleotides of the invention also preferably further includes a suitable C polyadenylation sequence the SV40 or human growth hormone gene Spolyadenylation sequence) operably linked downstream of the polypeptide- CI 10 coding sequence. The polynucleotides of the invention also preferably comprise a nucleotide sequence encoding a secretory signal peptide fused in-frame with the polypeptide sequence. The secretory signal peptide directs secretion of the polypeptide of the invention by the cells that express the polynucleotide, and is cleaved by the cell from the secreted polypeptide. The signal peptide sequence can be that of another secreted protein, or can be a completely synthetic signal sequence effective to direct secretion in cells of the mammalian subject.
The polynucleotide may further optionally comprise sequences whose only intended function is to facilitate large-scale production of the vector, in bacteria, such as a bacterial origin of replication and a sequence encoding a selectable marker.
However, in a preferred embodiment, such extraneous sequences are at least partially cleaved off prior to administration to humans according to methods of the invention.
One can manufacture and administer such polynucleotides to achieve successful gene therapy using procedures that have been described in the literature for other transgenes. See, Isner et al., Circulation, 91: 2687-2692 (1995); and Isner et al., Human Gene Therapy, 7: 989-1011 (1996); incorporated herein by reference in the entirety.
Any suitable vector may be used to introduce the transgene encoding one of the polypeptides of the invention, into the host. Exemplary vectors that have been described in the literature include replication-deficient retroviral vectors, including but not limited to lentivirus vectors [Kim et al., J. Virol., 72(1): 811-816 (1998); Kingsman Johnson, Scrip Magazine, October, 1998, pp. 43-46.]; adeno-associated
NO
-71viral vectors U.S. Patent No. 5,474,935; U.S. Patent No. 5,139,941; U.S. Patent z No. 5,622,856; U.S. Patent No. 5,658,776; U.S. Patent No. 5,773,289; U.S.
Patent No. 5,789,390; U.S. Patent No. 5,834,441; U.S. Patent No. 5,863,541; U.S. Patent No. 5,851,521; U.S. Patent No. 5,252,479; Gnatenko et al., J. Investig.
Med., 45: 87-98 (1997)]; adenoviral vectors [See, U.S. Patent No. 5,792,453; U.S. Patent No. 5,824,544; U.S. Patent No. 5,707,618; U.S. Patent No.
5,693,509; U.S. Patent No. 5,670,488; U.S. Patent No. 5,585,362; Quantin et al., C, Proc. Natl. Acad. Sci. USA, 89: 2581-2584 (1992); Stratford-Perricadet et al., J. Clin.
SInvest., 90: 626-630 (1992); and Rosenfeld et al., Cell, 68: 143-155 (1992)]; an C 10 adenoviral-adenoassociated viral hybrid (see for example, U.S. Patent No.
5,856,152) or a vaccinia viral or a herpesviral (see for example, U.S. Patent No.
5,879,934; U.S. Patent No. 5,849,571; U.S. Patent No. 5,830,727; U.S. Patent No. 5,661,033; U.S. Patent No. 5,328,688; Lipofectin-mediated gene transfer (BRL); liposomal vectors [See, U.S. Patent No. 5,631,237 (Liposomes comprising Sendai virus proteins)] and combinations thereof. All of the foregoing documents are incorporated herein by reference in their entirety. Replication-deficient adenoviral vectors constitute a preferred embodiment.
Other non-viral delivery mechanisms contemplated include calcium phosphate precipitation (Graham and Van Der Eb, Virology, 52:456-467, 1973; Chen and Okayama, Mol. Cell Biol., 7:2745-2752, 1987; Rippe et al., Mol. Cell Biol., 10:689-695, 1990) DEAE-dextran (Gopal, Mol. CellBiol., 5:1188-1190, 1985), electroporation (Tur-Kaspa et al., Mol. Cell Biol., 6:716-718, 1986; Potter et al., Proc. Nat. Acad. Sci. USA, 81:7161-7165, 1984), direct microinjection (Harland and Weintraub, J. CellBiol., 101:1094-1099, 1985.), DNA-loaded liposomes (Nicolau and Sene, Biochim. Biophys. Acta, 721:185-190, 1982; Fraley et al., Proc. Natl. Acad.
Sci. USA, 76:3348-3352, 1979; Felgner, Sci Am. 276(6):102-6, 1997; Felgner, Hum Gene Ther. 7(15):1791-3, 1996), cell sonication (Fechheimer et al., Proc. Natl. Acad.
Sci. USA, 84:8463-8467, 1987), gene bombardment using high velocity microprojectiles (Yang et al., Proc. Natl. Acad. Sci USA, 87:9568-9572, 1990), and receptor-mediated transfection (Wu and Wu, J Biol. Chem., 262:4429-4432, 1987;
NO
O -72- Wu and Wu, Biochemistry, 27:887-892, 1988; Wu and Wu, Adv. Drug Delivery Rev., O 12:159-167, 1993).
SIn a particular embodiment of the invention, the expression construct (or indeed the peptides discussed above) may be entrapped in a liposome. Liposomes are vesicular structures characterized by a phospholipid bilayer membrane and an inner F^aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the
C
N 10 lipid bilayers (Ghosh and Bachhawat, In: Liver diseases, targeted diagnosis and therapy using specific receptors and ligands, Wu G, Wu C ed., New York: Marcel Dekker, pp. 87-104, 1991). The addition of DNA to cationic liposomes causes a topological transition from liposomes to optically birefiingent liquid-crystalline condensed globules (Radler et al., Science, 275(5301):810-4, 1997). These DNA-lipid complexes are potential non-viral vectors for use in gene therapy and delivery.
Liposome-mediated nucleic acid delivery and expression of foreign DNA in vitro has been very successful. Also contemplated in the present invention are various commercial approaches involving "lipofection" teclnology. In certain embodiments of the invention, the liposome may be complexed with a hemagglutinating vinis (HVJ). This has been shown to facilitate fusion with the cell membrane and promote cell entry of liposome-encapsulated DNA (Kaneda et al., Science, 243:375-378, 1989). In other embodiments, the liposome may be complexed or employed in conjunction with nuclear nonhistone chromosomal proteins (HMG-1) (Kato et al., J.
Biol. Chem., 266:3361-3364, 1991). In yet further embodiments, the liposome maybe complexed or employed in conjunction with both HVJ and HMG-1. In that such expression constructs have been successfully employed in transfer and expression of nucleic acid in vitro and in vivo, then they are applicable for the present invention.
Other vector delivery systems that can be employed to deliver a nucleic acid encoding a therapeutic gene into cells include receptor-mediated delivery vehicles.
These take advantage of the selective uptake ofmacromolecules by receptor-mediated
(O
-73endocytosis in almost all eukaryotic cells. Because of the cell type-specific z distribution of various receptors, the delivery can be highly specific (Wu and Wu, 1993, supra).
Receptor-mediated gene targeting vehicles generally consist of two components: a cell receptor-specific ligand and a DNA-binding agent. Several ligands have been used for receptor-mediated gene transfer. The most extensively V, characterized ligands are asialoorosomucoid (ASOR) (Wu and Wu, 1987, supra) and Cl¢ N transferrin (Wagner et al., Proc. Nat'l. Acad Sci. USA, 87(9):3410-3414, 1990).
ID
SRecently, a synthetic neoglycoprotein, which recognizes the same receptor as ASOR, C, 10 has been used as a gene delivery vehicle (Ferkol et al., FASEB 7:1081-1091, 1993; Perales et al., Proc. Natl. Acad. Sci., USA 91:4086-4090, 1994) and epidermal growth factor (EGF) has also been used to deliver genes to squamous carcinoma cells (Myers, EPO 0273085).
In other embodiments, the delivery vehicle may comprise a ligand and a liposome. For example, Nicolau et al. (Methods Enzvnmol., 149:157-176, 1987) employed lactosyl-ceramide, a galactose-terminal asialganglioside, incorporated into liposomes and observed an increase in the uptake of the insulin gene by hepatocytes.
Thus, it is feasible that a nucleic acid encoding a therapeutic gene also may be specifically delivered into a particular cell type by any number ofreceptor-ligand systems with or without liposomes.
In another embodiment of the invention, the expression construct may simply consist of naked recombinant DNA or plasmids. Transfer of the construct may be performed by any of the methods mentioned above that physically or chemically penneabilize the cell membrane. This is applicable particularly for transfer in vitro, however, it may be applied for in vivo use as well. Dubensky et al. (Proc. Nat. Acad.
Sci. USA, 81:7529-7533, 1984) successfully injected polyomavirus DNA.in the fonn of CaPO 4 precipitates into liver and spleen of adult and newborn mice demonstrating active viral replication and acute infection. Benvenisty and Neshif(Proc. Nat. Acad.
Sci. USA, 83:9551-9555, 1986) also demonstrated that direct intraperitoneal injection of CaPO 4 precipitated plasmids results in expression of the transfected genes.
IO
-74- Another embodiment of the invention for transferring a naked DNA O expression construct into cells may involve particle bombardment. This method -O depends on the ability to accelerate DNA coated microprojectiles to a high velocity allowing them to pierce cell membranes and enter cells without killing them (Klein et al., Nature, 327:70-73, 1987). Several devices for accelerating small particles have been developed. One such device relies on a high voltage discharge to generate an electrical current, which in turn provides the motive force (Yang et al., Proc. Natl.
Cl cad. Sci USA, 87:9568-9572, 1990). The inicroprojectiles used have consisted of Sbiologically inert substances such as tungsten or gold beads.
S 10 In embodiments employing a viral vector, preferred polynucleotides still include a suitable promoter and polyadenylation sequence as described above.
Moreover, it will be readily apparent that, in these embodiments, the polynucleotide further includes vector polynucleotide sequences adenoviral polynucleotide sequences) operably connected to the sequence encoding a polypeptide of the invention.
Thus, in one embodiment the composition to be administered comprises a vector, wherein the vector comprises a polynucleotide of the invention. In a preferred embodiment, the vector is an adenovirms vector. In a highly preferred embodiment, the adenovirus vector is replication-deficient, it cannot replicate in the mammalian subject due to deletion of essential viral-replication sequences from the adenoviral genome. For example, the inventors contemplate a method wherein the vector comprises a replication-deficient adenovirus, the adenovirus comprising the polynucleotide of the invention operably connected to a promoter and flanked on either end by adenoviral polynucleotide sequences.
Similarly, the invention includes kits which comprise compounds or compositions of the invention packaged in a manner which facilitates their use to practice methods of the invention. In a simplest embodiment, such a kit includes a compound or composition described herein as useful for practice of the invention polynucleotides or polypeptides of the invention), packaged in a container such as a sealed bottle or vessel, with a label affixed to the container or included in the package that describes use of the compound or composition to practice the method of
NO
the invention. Preferably, the compound or composition is packaged in a unit dosage 0 form. In another embodiment, a kit of the invention includes a composition of both a polynucleotide or polypeptide packaged together with a physical device useful for implementing methods of the invention, such as a stent, a catheter, an extravascular collar, a polymer film, or the like. In another embodiment, a kit of the invention includes compositions of both a polynucleotide or polypeptide of the invention V) packaged together with a hydrogel polymer, or microparicle polymers, or other Ce¢ CI carriers described herein as useful for delivery of the polynucleotides or polypeptides 0to the patient.
c 10 The polypeptides of the present invention are useful in diagnostic or prognostic assays for detecting VEGF receptor protein expression. Polypeptides of the invention that bind to one or more VEGF receptors may be used for detecting and measuring the presence of specific receptor proteins in samples for purposes such as medical imaging, detection, screening, or targeted therapy. Detectable labels such as radioactive or non-radioactive labels, including enzyme labels or labels of the biotin/avidin system, may be used to tag the polypeptide of the invention. The polypeptide may also be covalently or non-covalently coupled to a suitable supermagnetic, paramagnetic, electron dense, ecogenic or radioactive agent for imaging.
The present invention also relates to a diagnostic assay for detecting altered levels of VEGF receptor proteins in various tissues since over-expression of the proteins compared to normal control tissue samples may detect the presence of a disease or susceptibility to a disease, for example, abnormal cell growth or differentiation. Polypeptides of the invention can be used to quantify future metastatic risk by assaying biopsy material for the presence of active receptors or ligands in a binding assay or kit using detectably-labeled polypeptides of the invention.
A related aspect of the invention is a method for the detection of specific cells, endothelial cells. These cells may be found in vivo, or in ex vivo biological tissue samples. The method of detection comprises the steps of contacting a biological tissue comprising, endothelial cells, with a hybrid polypeptide according to the
ID
-76invention which is capable of binding to VEGFR(s), under conditions wherein the 0 hybrid polypeptide binds to the cells, optionally washing the biological tissue, and O detecting the hybrid polypeptide bound to the cells in the biological tissue, thereby detecting the cells. It will be apparent that certain polypeptides of the invention are useful for detecting and/or imaging cells that express more than one VEGFR, whereas nother polypeptides are useful for imaging cells which specifically express a particular
SVEGFR.
SThe invention also is directed to a method for imaging vertebrate tissue Ssuspected of containing cells that express a specific VEGFR comprising the steps of: contacting vertebrate tissue with a composition comprising polypeptide(s) of the invention that specifically bind the particular VEGFR; and imaging the tissue by detecting the VEGFR- binding polypeptide bound to the tissue. Preferably, the tissue is human tissue, and the method further comprises the step of washing the tissue, after the contacting step and before the imaging step, under conditions that remove from the tissue polypeptides that are not bound to the VEGFR in the tissue.
In a related variation, the invention provides a method for imaging tumors in tissue from a vertebrate organism, comprising the steps of: contacting vertebrate tissue suspected of containing a tumor with a composition comprising a VEGFR binding compound; detecting the VEGFR binding compound bound to cells in said tissue; and imaging solid tumors by identifying blood vessel endothelial cells bound by the VEGFR binding compound, wherein blood vessels expressing VEGFR are correlated with the presence and location of a tumor in the tissue.
The present invention also is directed to the use of hybrid polypeptides of the invention that bind VEGF receptors as specific markers for particular tissues and cell types. For example, those polypeptides of the invention that specifically bind VEGFR-3 can serve as markers for lymphatic endothelial cells.
Similarly, polypeptides of the invention may be screened for an ability to modulate the growth of isolated cells or cell lines. For example, certain neoplastic disease states are characterized by the appearance of VEGF receptors on cell surfaces [Valtola et al., Am JPath 154:1381-90 (1999)]. Polypeptides of the invention may be screened to determine the ability of the polypeptide to modulate the growth of the
ID
-77neoplastic cells. Other disease states are likely characterized by mutations in VEGF 0 receptors [Ferrell el al., Hum Mol Genetics 7:2073-78 (1998)]. Polypeptides of lhe invention that modulate the activity of the mutant forms of the VEGF receptor in a manner different than naturally-occurring vascular endothelial growth factors will be useful at modulating the symptoms and severity of the such disease states.
In vivo imaging or tissue biopsy may reveal that certain neoplastic cells are in expressing a particular combina ion of receptors, thereby providing an indication for Cl polypeptides of the invention that bind the expressed set of receptors and inhibit 0ligand mediated growth.
f" 10 The use of such diagnostic imaging is particularly suitable in obtaining an image of, for example, a tumor mass or the neovascularizarion near a tumor mass. It is contemplated that the peptides of the present invention may be employed for imaging in a manner analogous to the antibody-based methods disclosed in U.S.
Patent No. 6,107,046, incorporated herein by reference.
Many appropriate imaging agents are known in the art, as are methods of attaching the labeling agents to the peptides of the invention (see, U.S. Patent No.
4,965,392, U.S. Patent No. 4,472,509, U.S. Patent No. 5,021,236 and U.S. Patent No.
5,037,630, incorporated herein by reference). The labeled peptides are administered to a subject in a phannaceutically acceptable carrier, and allowed to acctunulate at a target site having the VEGFR-3 receptor. This peptide imaging agent then serves as a contrast reagent for X-ray, magnetic resonance, sonographic or scintigraphic imaging of the target site. The peptides of the present invention are a convenient and important addition to the available arsenal of medical imaging tools for the diagnostic investigation of cancer and other VEGFR-3 related disorders.
Paramagnetic ions useful in the imaging agents of the present invention include for example chromium (ILI), manganese iron iron cobalt (II), nickel (II) copper neodymium samarium ytterbium(II), gadolinium vanadium terbium dysprosium holmium (I1) and erbium (III).
Ions useful for X-ray imaging include but are not limited to lantanum (III), gold(III), lead (11) and particularly bismuth Radioisotopes for diagnostic applications include for example, 21 astatine, 14carbon, "chromium, 3 6 chlorine, 5 cobalt, "copper, 8 -78- -S"Eu, "gallium, 3 hydrogen, 23 iodine, 2 iodine, '"indium, "iron, phosphorus, O '1-rhenium, 7 Sseleliumn, "sulphur, 9 '"technicium and ')"yttriulm.
The peptides of the present invention may be labeled according to techniques well known to those of skill in the art. For example, the peptides can be iodinated by contacting the peptidc with sodium or potassium iodide and a chemical oxidizing agent such as sodium hypochlorite or an enzymatic oxidant such as lactoperoxidase.
ltr Peptides may be labeled with technetium-99in by ligand exchange, for example, by reducing perteclnate with stannous solution, chelating the reduced technetium onto a Sephadex column and applying the peptide to the column. These and other techniques for labeling proteins and peptides are well known to those of skill in the art.
Using Polypeptides of the Invention in Combined Therapy for Neoplastic Disorders Tumor cell resistance to DNA damaging agents represents a major problem in clinical oncology. One goal of current cancer research is to find ways to improve the efficacy ofchemo- and radiotherapy. As described above, the peptides of the present invention may be administered in conjunction with chemo- or radiotherapeutic intervention, immunotherapy, or with other anti-angiogenic/anti-lymphangiogenic therapy.
To kill cells, inhibit cell growth, inhibit metastasis, inhibit angiogenesis or otherwise reverse or reduce the malignant phenotype of tumor cells via combination therapy, using the methods and compositions of the present invention, one would generally contact a "target" cell or tissue, a tumor and/or its vasculature) with the therapeutic peptides of the present invention (either as a peptide composition or as an expression construct that will express the peptide) and at least one other agent, which optionally is conjugated to the peptide of the invention. These compositions would be provided in a combined amount effective to kill or inhibit proliferation of the cancer by killing and/or inhibiting the proliferation of the cancer cells and/or the endothelia of blood and lymphatic vessels supplying and serving the cancer cells. This process may involve contacting the cells with the peptide or expression construct and the agent(s) or factor(s) at the same time. This may be achieved by contacting the cell
,D
-79-
CN
with a single composition or pharmacological formulation that includes both agents, 0 or by contacting the cell with two distinct compositions or formulations, at the same time, wherein one composition includes the peptide or expression construct and the other includes the second agent.
Alternatively, the therapeutic treatment employing Ihe peptides of the present invention may precede or follow the other agent treatment by intervals ranging from t) minutes to weeks. hi embodiments where the other agent and expression construct Cl are administered separately, one would generally ensure that a significant period of 0time did not expire between the time of each delivery, such that the agent and the C, 10 peptide-based therapeutic would still be able to exert an advantageously combined effect. h such instances, it is contemplated that one would administer both modalities within about 12-24 hours of each other and, more preferably, within about 6-12 hours of each other, with a delay time of only about 12 hours being most preferred. In some situations, it may be desirable to extend the time period for treatment significantly, however, where several days 3, 4, 5, 6 or 7) to several weeks 2, 3, 4, 5, 6, 7 or 8) lapse between the respective administrations. Repeated treatments with one or both agents is specifically contemplated. In specific embodiments, an anti-cancer therapy may be delivered which directly attacks the cancer cells in a manner to kill, inhibit or necrotize the cancer cell, in addition a therapeutic composition based on the peptides of the present invention also is administered to the individual in amount effective to have an antiangiogenic and/or anti-lymphangiogenic effect. The peptide compositions may be administered following the other anti-cancer agent, before the other anti-cancer agent or indeed at the same time as the other anti-cancer agent, optionally conjugated to the other agent.
Agents or factors suitable for use in a combined therapy are any chemical compound or treatment method that induces DNA damage when applied to a cell.
Such agents and factors include radiation and waves that induce DNA damage such as, y-irradiation, X-rays, UV-iradiation, microwaves, electronic emissions, and the like.
A variety of chemical compounds, also described as "chemotherapeutic agents," function to induce DNA damage, all of which are intended to be of use in the combined treatment methods disclosed herein. Chemotherapeutic agents contemplated to be of use, include,
D
0 adriamycin, 5-fluorouracil (5FU), etoposide (VP-16), camptothecin, actinomycin-D, mitomycin C, cisplatin (CDDP) and even hydrogen peroxide. The invention also O encompasses the use of a combination of one or more DNA damaging agents, whether Sradiation-based or actual compounds, such as the use of X-rays with cisplatin or the use of cisplatin with etoposide.
In treating cancer according to the invention, one would contact the tumor cells and/or the endothelia of the tumor vessels with an agent in addition to the therapeutic t agent comprising one or more peptide of the present invention. This may be achieved by O irradiating the localized tumor site with radiation such as X-rays, UV-light, gamma-rays or 0 10 even microwaves. Alternatively, the tumor cells may be contacted with the agent by administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising a compound such as, adriamycin, 5-fluorouracil, etoposide, camptothecin, actinomycin-D, mitomycin C, or cisplatin. Kinase inhibitors also contemplated to be useful in combination therapies with the peptides of the present invention. The agent may be prepared and used as a combined therapeutic composition, or kit, by combining it with a chimeric peptide of the invention, as described above.
Agents that directly cross-link nucleic acids, specifically DNA, are envisaged to facilitate DNA damage leading to a synergistic, antineoplastic combination with chimeric peptide -based therapy. Agents such as cisplatin, and other DNA alkylating agents may be used. Cisplatin has been widely used to treat cancer, with efficacious doses used in clinical applications of 20 mg/m 2 for 5 days every three weeks for a total of three courses.
Cisplatin is not absorbed orally and must therefore be delivered via injection intravenously, subcutaneously, intratumorally or intraperitoneally.
Agents that damage DNA also include compounds that interfere with DNA replication, mitosis and chromosomal segregation. Such chemotherapeutic compounds include adriamycin, also known as doxorubicin, etoposide, verapamil, podophyllotoxin, and the like. Widely used in a clinical setting for the treatment of neoplasms, these compounds are administered through bolus injections intravenously at doses ranging from 25-75 mg/m 2 at 21 day intervals for adriamycin, to 35-50 mg/m 2 for etoposide intravenously or double the intravenous dose orally.
ID
-81- Agents that disrupt the synthesis and fidelity of nucleic acid precursors and 0 Z subuirts also lead to DNA damage. As such a number of nucleic acid precursors have been developed. Particularly useful are agents that have undergone extensive testing and are readily available. As such, agents such as 5-fluorouracil are preferentially used by neoplaslic tissue, making this agent particularly useful for targeling to neoplastic cells. Although quite toxic, 5-FU, is applicable in a wide range ofcarriers, including t^ topical, however intravenous administration with doses ranging fiom 3 to 15 mg/kg/day Cl¢ 6 being commonly used.
SBy way of example the following is a list ofchrnotherapcutic agents and the C 10 cancers which have been shown to be managed by administration of such agents.
Combinations of these chemotherapeutics with the peptides of the present invention may prove to be useful in amelioration of various neoplastic disorders. Examples of these compounds include adriamycin (also known as doxorubicin), VP-16 (also known as etoposide), and the like, daunonrbicin (intercalates into DNA, blocks DNA-directed RNA polymerase and inhibits DNA synthesis); mitomycin (also known as mutamycin and/or mitomycin-C) is an antibiotic isolated from the broth of Streptomyces caespitosus which has been shown to have antitumor activity; Actinomycin D also may be a useful drug to employ in combination with the peptides of the present invention because tumors which fail to respond to systemic treatment sometimes respond to local perfusion with dactinomycin which also is known to potentiate radiotherapy. It also is used in combination with primary surgery, radiotherapy, and other drugs, particularly vincristine and cyclophosphamide and has been found to be effective against Ewing's tumor, Kaposi's sarcoma, and soft-tissue sarcomas, choriocarcinoma, metastatic testicular carcinomas, Hodgkin's disease and non-Hodgkin's lymphomas.
Bleomycin is a mixture of cytotoxic glycopeptide antibiotics isolated from a strain of Streptomyces verticillus, is effective in the management of the following neoplasms either as a single agent or in proven combinations with other approved chemotherapeutic agents in squamous cell carcinoma such as head and neck (including mouth, tongue, tonsil, nasopharynx, oropharynx, sinus, palate, lip, buccal mucosa, gingiva, epiglottis, larynx), skin, penis, cervix, and vulva. It has also been used in the treatment of lymphomas and testicular carcinoma.
OD
8 -82- SCisplatin has been widely used to treat cancers such as metastatic testicular or O ovarian carcinoma, advanced bladder cancer, head or neck cancer, cervical cancer, lung cancer or other tumors and may be a useful combination with the peptides of the present invention. VP16 (etoposide) and is used primarily for treatment of testicular tumors, in combination with bleomycin and cisplatin, and in combination with cisplatin for smallcell carcinoma of the lung. It is also active against non-Hodgkin's lymphomas, acute In) nonlymphocytic leukemia, carcinoma of the breast, and Kaposi's sarcoma associated with acquired immunodeficiency syndrome (AIDS). Tumor Necrosis Factor [TNF; Cachectin] glycoprotein that kills some kinds of cancer cells, activates cytoline production, activates macrophages and endothelial cells, promotes the production of collagen and collagenases, is an inflammatory mediator and also a mediator of septic shock, and promotes catabolism, fever and sleep. TNF can be quite toxic when used alone in effective doses, so that the optimal regimens probably will use it in lower doses in combination with other drugs. Its innunosuppressive actions are potentiated by y-interferon, so that the combination potentially is dangerous. A hybrid of TNF and interferon-a also has been found topossess anti-cancer activity.
Taxol an antimitotic agent original isolated fiomn the bark of the ash tree, Taxus brevifolia, and its derivative paclitaxol have proven useful against breats cancer and may be used in the combination therapies of the present invention. Beneficial responses to vincristine have been reported in patients with a variety of other neoplasms, particularly Wilms' tumor, neuroblastoma, brain tumors, rhabdomyosarcoma, and carcinomas of the breast, bladder, and the male and female reproductive systems. Vinblastine also is indicated as a useful therapeutic in the same cancers as vincristine. The most frequent clinical use of vinblastine is with bleomycin and cisplatin in the curative therapy of metastatic testicular tumors. It is also active in Kaposi's sarcoma, neuroblastoma, and Letterer-Siwe disease (histiocytosis as well as in carcinoma of the breast and choriocarcinoma in women.
Melphalan also known as alkeran, L-phenylalanine mustard, phenylalanine mustard, L-PAM, or L-sarcolysin, is a phenylalanine derivative of nitrogen mustard.
Melphalan is a bifunctional alkylating agent which is active against selective human neoplastic diseases. Melphalan is the active L-isomer of the D-isomer, known as
O
-83medphalan, which is less active against certain animal tumors, and the dose needed to 0 produce effects on chromosornes is larger than that required with the L-isomer.
Melphalan is available in fonn suitable for oral administration and has been used to treat multiple myeloma. Available evidence suggests that about one third to one half of the patients with multiple myeloma show a favorable response to oral administration of the drug. Mclphalan has been used in the treatment of epithelial ovarian carcinoma.
l Cyclophosphamide is stable in the gastrointestinal tract, tolerated well and CI effective by the oral and parental routes and does not cause local vesication, necrosis, phlebitis or even pain. Chlorambucil, a bifunctional alkylating agent of the nitrogen C' 10 mustard type that has been found active against selected human neoplastic diseases.
Chlorambucil is indicated in the treatment ofcluhonic lymphatic (lymphocytic) leukemia, malignant lymphomas including lymphosarcoma, giant follicular lymphoma and Hodglin's disease. It is not curative in any of these disorders but may produce clinically useful palliation.
Other factors that cause DNA damage and have been used extensively include what are commonly known as gamma-rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells. Other forms of DNA damaging factors are also contemplated such as microwaves and UV-irradiation. It is most likely that all of these factors effect a broad range of damage DNA, on the precursors of DNA, the replication and repair of DNA, and the assembly and maintenance of chromosomes. Dosage ranges for X-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 weeks), to single doses of 2000 to 6000 roentgens. Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells. (See, Remington's Pharmaceutical Sciences" 15th Edition, chapter 33, in particular pages 624-652.) Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, detennine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biologics standards.
O -84- In addition to combining chimeric peptide -based therapies with chemo- and O radiotherapies, it also is contemplated that combination with gene therapies will be Sadvantageous. For example, targeting of chimeric peptide -based therapies and p53 or p16 mutations at the same time may produce an improved anti-cancer treatment. Any other tumor-related gene conceivably can be targeted in tils manner, for example, p 2 1, Rb, APC, DCC, NF--I, NF-2, BCRA2, p16, FHIT, WT-1, MEN-I, MIEN-fl, BRCAI, V) VHT-L, FCC, MCC, ras, inyc, neu, raf, erb, src, fins, jun, trk, ret, gsp, list, bcl and abl.
(Cf, In addition to the anticancer therapeutics discussed above, it is contemplated that
O
the peptides of the invention may be combined with other angiogenesis inhibitors. The S 10 peptides of the present invention are expected to have both anti-lymphangiogenic and antiangiogenic properties. Many anti-angiogenic drugs also may have anti-lymphangiogenic properties. http://cancertrials.nci.nih.gov/news/angio is a website maintained by the National Institutes of Health which provides current information on the trials presently being conducted with anti-angiogenic agents. These agents include, for example, Marimastat (British Biotech, Annapolis MD; indicated for non-small cell lung, small cell lung and breast cancers); AG3340 (Agouron, LaJolla, CA; for glioblastoma multiforme); COL-3 (Collagenex, Newtown PA; for brain tumors); Neovastat (Aetema, Quebec, Canada; for kidney and non-small cell lung cancer) BMS-275291 (Bristol-Myers Squibb, Wallingford CT; for metastatic non-small cell ling cancer); Thalidomide (Celgen; for melanoma, head and neck cancer, ovarian, metastatic prostate, and Kaposi's sarcoma; recurrent or metastatic colorectal cancer (with adjuvants); gynecologic sarcomas, liver cancer; multiple myeloma; CLL, recurrent or progressive brain cancer, multiple myeloma, non-small cell lumg, nonmetastatic prostate, refractory multiple myeloma, and renal cancer); Squalamine (Magainin Pharmaceuticals Plymouth Meeting, PA; non-small cell cancer and ovarian cancer); Endostatin (EntreMEd, Rockville, MD; for solid tumors); SU5416 (Sugen, San Francisco, CA; recurrent head and neck, advanced solid tumors, stage 1ilB or IV breast cancer; recurrent or progressive brain (pediatric); Ovarian, AML; glioma, advanced malignancies, advanced colorectal, von-Hippel Lindau disease, advanced soft tissue; prostate cancer, colorectal cancer, metastatic melanoma, multiple myeloma, malignant mesothelioma: metastatic renal, advanced or recurrent head and neck, metastatic colorectal cancer); SU6668 (Sugen San Francisco, CA; advanced tumors); interferon-a; Anti-VEGF antibody (NAtional Cancer Institute, Bethesda MD; Z Genentech San Franscisco, CA; refractory solid tunmors; metastatic renal cell cancer, in 0 untreated advanced colorectal); EMD121974 (Merck KCgaA, Darmstadt, Germany; HIV related Kaposi's Sarcoma, progressive or recurrent Anaplastic Glioma Interleukin 12 (Genetics Institute, Cambridge, MA; Kaposi's sarcoma) and IM862 (Cytran, Kirkland, SWA; ovarian cancer, untreated metastatic cancers of colon and rectal origin and Kaposi's sarcoma). The parenthetical information following the agents indicates the cancers Cl¢ c against which the agents are being used in these trials. It is contemplated that any of these
ID
0 disorders may be treated with the peptides of the present invention either alone or in CI 10 combination with the agents listed.
Additional features of the invention will be apparent from the following Examples.
Example 1 Construction of VEGF-A/VEGF-C hybrid molecules: Although the amino acid residues of the receptor binding domain of VEGF family members are share conserved motifs, these proteins exhibit different receptor specificities.
In the following experiment, DNA molecules encoding polypeptides containing different portions of the receptor binding domains of either VEGF-A or VEGF-C were constructed using a combinatorial approach to create novel hybrid molecules with unique structural and functional characteristics.
To generate the novel molecules, the nucleotide sequences of VEGF-A and mature VEGF-C were analyzed to determine localized regions of nucleotide identity which would be suitable for designing short DNA fragments which could be synthesized and readily recombined. Eight corresponding regions of identity were selected in each molecule as sites for fragmentization (into nine fragments) and recombination into chimeric (hybrid) molecules. These fragmentation sites were chosen based on nucleotide sequence and also because the resultant fragments would correspond to structural elements alpha helix, loop, etc.) based on the crystal structure of VEGF-A (see Fig.
1).
Fragmentation of VEGF-A
O
-86- Nine pairs of synthetic oligonucleotides were designed based on the coding sequence for VEGF,2h, fo Ile purpos of fOrming nine DNA fragments that encompass the receptor binding domain encoding region of VEGF-A (corresponding to nucleotides 156 to 461 of SEQ ID NO: 1, whiich encode amino acid residues 34 to 135 of SEQ D NO: Each oligonuicleotide pair comprised a forward primer containing coding sequencc and a reverse pnrmer with nucleotide sequence comnplcmrentary to a portion of tf the forward primer, to permit annealing of the primers to each other into a double-stranded CK DNA fiagment. Either the forward or reverse primer of each pair also included a short
O
and 3' nucleotide sequence that was not complementary to any sequence of its paired primer. These short additional sequences correspond to the localized regions of nucleotide identity set forth above. Following annealing of primer pairs, this additional sequence fonnrmed single-stranded overhangs compatible with annealing with other doublestranded amnnealed primer pairs, as described in greater detail below. The nucleotide sequences fiom the VEGF-A forward and reverse primers are set forth below in Tables 1 A and 1B, respectively.
Table IA Forward (Coding) Primers for VEGF-A Al-F gat cCT GGG CAG AAT CAT CAC GAA GTG Gtg aaa t D P G Q N H H E V V K A2-F TC ATG GAT GTC TAT CAG CGC AGC TAC TGC CAT F M D V Y Q R S Y C H A3-F ccg aTC GAG ACA CTG GTO GAC ATC TTC CAG GAATAGAAGAGC P I E T L V D I F Q A4-F CGCTCTTCGAA TAC CCT GAT GAG ATC GAG TAC A E Y P D E I E Y A5-F tc tte aag cca TCC TGC GTG CCC CTG ATG AGA TGT GGC IFKPSCVPLMRCG C AG-F CCG GGT TGC TGC AAT GAC GAA GGG CTC G G C C N D E G L A7-F ag tgC GTT CCC ACC GAG GAG TCC AAC ATC ACC ATG CAG ATT ATG AG E C V P T E E S N I T M Q I M R A8-F a att AAA CCT CAC CAA GGG CAG CAC ATC GGA GAG ATG agc ttt I K P H Q G Q H I G E M S F A9-F CTC CAG CAT AAC AAA TGT GAA TGT AGA CCA AAG AAA GATTGAGTCTTCGC L Q H N K C E C R P K K D O 87
O
SThe nucleotide sequences of forward primers Al -F to A9-F are set forth in SEQ ID NOs 3-11, respectively. For each of the primers listed, the top strand shows the DNA Ssequence and the bottom strand indicates the amino acids encoded by that particular C_ primer (SEQ ID NOs: 128-136, respectively). In some instances, only two nucleotides of a given codon is contained in one primer, and the remaining nucleotide of the codon is contained in the preceding or following primer. In these cases, the amino acid is listed under the primer that contains 2 out of the 3 nucleotides of that particular codon.
l^ Boldface type indicate nucleotides coding for amino acids that constitute a protein
V))
linker region and are not part of the parent VEGF-A or VEGF-C molecule; underlined C 10 nucleotides are those that are removed during assembly of the fragments into hybrid 0 constructs and the lowercase letters are those nucleotides that produce an overhang when the oligonucleotide pairs are annealed to each other to produce the 9 fragments.
Table IB-Reverse (Non-Coding Primers for VEGF-A Al-R CCACTTCGTGATGATTCTGCCCAG A2-R tcggATGGCAGTAGCTGCGCTGATAGACATCCATGAatttca A3-R tcqaGCTCTTCTATTCCTGGAAGATGTCCACCAGTGTCTCGA A4-R tggcttgaagatGTACTCGATCTCATCAGGGTATTCGAAGAGCGqtac A5-R catgGCCACATCTCATCAGGGGCACGCAGGA A6-R gcactCCAGCCCTTCGTCATTGCAGCAACCCGGGTAC A7-R aattCTCATAATCTGCATGGTGATGTTGGACTCCTCGGTGGGAAC A8-R CATCTCTCCGATGTGCTGCCCTTGGTGAGGTTT A9-R GGCCGCGAAGACTCAATCTTTCTTTGGTCTACATTCACATTTGTTATGCTGGAGaaagct The nucleotide sequences of reverse primers AI-R to A9-R are set forth in SEQ ID NOs 12-20, respectively. Boldface, underlined and lowercase letters are used as described in Table 1A.
Nine VEGF-A polynucleotide fragments were assembled by annealing a matched pair of synthetic oligonucleotide primers. For example, fragment Al was created by annealing primer Al-F with primer AI-R, fragment A2 was created by annealing A2-F with A2-R, and so on. Annealing was accomplished by incubating 2 pmol/pl of each appropriate primer, 20 mM Tris/HCI, 2mM MgCl 2 and 50 mM NaCI, pH 7. 4 at 95 0 C for 5 minutes, followed by cooling of the solution to 37 0 C at a rate of l1C/minute. As shown 88
O
O
in Table 1A, fragment Al encodes amino acid residues 34 to 42, and part of amino acid 43 of SEQ ID NO 2; fragment A2 encodes part of amino acid 43, and amino acids
O
S44-53 of SEQ ID NO 2, fragment A3 encodes amino acids 54 to 63, and part of amino O acid 64 of SEQ ID NO 2 fragment A4 encodes part of amino acid 64, amino acids to 71, and part of amino acid 72 of SEQ ID NO 2 fragment A5 encodes part of amino acid 72, amino acids 73 to 83, and part of amino acid 84 of SEQ ID NO 2; fragment A6 encodes part of amino acid 84, amino acids 85 to 92, and part of amino acid 93 of SEQ ID NO 2 fragment A7 encodes part of amino acid 93, amino acids 94 e to 107, and part of amino acid 108 of SEQ ID NO 2 fragment A8 encodes part of 0D 10 amino acid 108, and amino acids 109 to 122 of SEQ ID NO :2 and fragment A9 O encodes amino acids 123 to 135 of SEQ ID NO 2.
C"l Fragmentation of VEGF-C In a similar manner, nine pairs of oligonucleotides were designed and synthesized based upon the amino acid sequence of the receptor binding domain of VEGF-C (corresponding to nucleotides 658 to 999 of SEQ ID NO 21, which encode amino acid residues 112 to 216 of SEQ ID NO 22). The nucleotide sequences of the nine forward primers and nine reverse primers are set forth in Table 2A (SEQ ID NOs 23-31) and Table 2B (SEQ ID NOs 32-40), respectively. The amino acid sequences encoded by the nine forward primers are set forth in SEQ ID NOs: 137-145, respectively.
Table 2A-Forward (Coding) Primers for VEGF-C Cl-F gat cCT GCA CAT TAT AAT ACC GAG ATC Ctg aaa t D P A H Y N T E I L K C2-F CT ATT GAT AAT GAG TGG AGA AAG ACT CAG TGC ATG S I D N E W R K T 0 C M C3-F ccg aGA GAG GTG TGT ATC GAC GTG GGG AAG GAATAGAAGAGC P R E V C I D V G K C4-F CGCTCTTCGAA TTT GGA GTC GCG ACA AAC ACC T E F G V A T N T tc ttc aag cca CCA TGT GTG TCC GTG TAC AGA TGT GGC F F K P p C V S V Y R C G CG-F CCG GGT TGC TGC AAT AGT GAG GGG CTG C G C C N S E G L C7-F ag tgc ATG AAC ACG TCC ACG AGC TAC CTC AGC AAG ACG CTG TTT GA Q C M N T S T S Y L S K T L F E -89- C8-F a att ACA GTG CCI CTC 'rCr CAA GGG CCC AAA CCA GTG ACA ATC agcttt T T V P L S Q G P K P V T I S F C9-F GCC AAT CAC ACT TCC TGC CGA TGC ArG TCT AAG C'rG GATTGAGTCTTCGC A N H T S C R C M S K L D Cl-R C2-R C3-R C4-R C6-R C7 -R C8-R C9-R Table 21 Forward (Cocling) Primers for EGF-C
GGATCTCGGTATTATAA'IGTGCAG
tcggCATGCACTGAGTCTTTCTCCACTCATTCdAGat ttca tcqaGCTCTTCTATTCC'TCCCCACGTCGATACACACCTCTC tggcttgaagaAGGTGl'TTGTCGCGACTCCAAATTCGAAGAGCGgtac ca tqGCCACATCTGTACACGGACACACATGG gcactGCAGCCCCTCACTATTGCAGCAACCC~gqctac aat tTCAAAC-AGCGTCTTGCTGAGGTAGCTCGTGGACGTGTTCAT GATTGTCACTGGrTGGGCCCThJAGAGAGAG(GCACTGT gg ccGCGAAGACTCAATCCAGCITAGACATGCATCGGCAGGAAGTGTGATTGGCaaagct Boldface, underlined and lowercase letters are used in Tables 2A and 2B as described in Tuible 1A.
Primer pairs were annealed to form nine double-stranded DNA fragnents which together encoded the receptor binding domain of VEGF-C, and which possessed appropinate single strandcd ovcrhangs for anealing to other fragnents, as described above for VEGF-A.
Fragment Cl encodes amnino acid residues 112 to 120, and pat of amino acid 121 of SEQ ID NO: 22; fragm-ent C2 encodes part of amiino acid 121 and anino acids 122 to 132 of SEQ ID NO: 22; fragment C3 encodes amino acids 133 to 142, and part of amnino acid 143 of SEQ ID NO: 22; fragment C4 encodes part of amino acid 143, amino acids 144 to 150, and part of amino acid 151 of SEQ ED NO: 22; fragment C5 encodes part of amino acid 151, amino acids 152 to 162, and part of amino acid 163 of SEQ ID NO: 22; fragment C6 encodes part of amino acid 163, and amino acids 164 to 171, and part of amino acid 172 of SEQ ID NO: 22; fragment C7 encodes part of amino acid 172, amnino acids 173 to 186, and part of amino acid 187 of SEQ ID NO: 22; fragment C8 encodes part of aino acid 187, amino acid 188 to 203 of SEQ DD NO: 22; anid fragnicut C9 encodes amino acid 204 to 216 of SEQ DD NO: 22.
ID
Discussion reegrdjng the synthesis of the VEGF-A and VEGF-C fragments z Thus, by synthesizing and annealing nine pairs of pruners designed fiom the VEGF-A amino acid sequence and nine pairs of primers designed from the VEGF-C amino acid sequence, eighteen DNA fiagments were generated. Figue 2 is a schematic diagram illustrating the construction of the 9 VEGF-A and 9 VEGF-C DNA fiagments.
The oligonucleotides were designed to produce double-stranded DNA fragments Scontaining unique cohesive ends upon annealing. Ligation of the 9 VEGF-A DNA C fiaginents produces a single linear double-stranded DNA encoding airlno acids 34-135 of VEGF-A (SEQ ID NO: and ligation of the 9 VEGF-C DNA fragments results in a S 10 single DNA encoding amino acids 112-216 of VEGF-C (SEQ ID NO: 22).
While the insertion of cohesive ends greatly facilitated ligation of fragments in a desired order and orientation, it will be appreciated that ligation of fiagments can also be accomplished without cohesive ends. Blunt-end fragments also can be synthesized and annealed to generate hybrid proteins using the method described above. With a blunt-end strategy, the nucleotide sequences of the parent molecules do not need to be examined for the presence of nucleotide identity to enable the creation of cohesive ends. However, additional post-ligation screening may be required to identify hybrids that contain fragments in the desired order and orientation.
Several additional details regarding the synthetic primers and the double-stranded DNA fragments deserve emphasis. First, it is worth noting that, for VEGF-A fragment Al and VEGF-C fragment Cl, the first two encoded amino acids, Asp and Pro, constitute a protein linker (encoded by an engineered BamHl recognition site) and do not correspond to either VEGF-A or VEGF-C sequences.
Second, referring to Figures 1 and 2, it is noteworthy that many of the fragments were designed to correspond to discrete structural elements within the receptor binding domain of VEGF family proteins. Fragment 2 corresponds to the N-terminal helix; fragment 4 corresponds to P2; fragment 6 corresponds to the p3-P4 loop, fragment 7 corresponds to 05; fragment 8 corresponds to the 05-p6 loop; and fragment 9 corresponds to 17.
Third, it is noteworthy that the thirty-six oligonucleotides that were designed do not correspond exactly with native human VEGF-A or VEGF-C cDNA sequences
NO
0-91- DNA counterparts of naturally-occuring human mRNA sequences), notwithstanding the z fact that the oligonucleotides were designed to retain encoded amino acid sequences of the human VEGF-A and VEGF-C polypeptides. For example, the oligonucleotides were designed such that the native (endogenous) htunan nucleotide sequence encoding the receptor binding domain for both VEGF-A and VEGF-C were modified to generate new restriction sites, to provide longer stretches of nucleotide identity where overlaps were desired between the and fragments, or to improve codon usage for expression in rhuman cell culture. All nucleotide mutations (relevant to the native sequences) were
ID
Ssilent Thus, the amino acid sequences of the receptor binding domain of VEGF-A C 10 (resulting fiom annealing fragments A1-A9) and VEGF-C (fiom annealing fragments Cl- C9) are identical to that of the respective parent molecule.
Fourth, referring again to Figure 2, it is noteworthy that each of the nine VEGF-A fragments aligns with the corresponding VEGF-C fragment, and has a compatible cohesive end to anneal to adjacent fragments from the other molecule. For example, fragments Al and Cl correspond to the same relative portions of VEGF-A and VEGF-C, respectively, and have identical top strand cohesive ends. These cohesive ends are exactly complementary to bottom strand cohesive ends of both fragments A2 and C2, such that Al could anneal to either A2 or C2, and C1 also could anneal to A2 or C2. Fragments A2 and C2 correspond to the same relative portions of VEGF-A and VEGF-C, and each possesses another bottom strand cohesive end that is exactly complementary to top strand cohesive ends of fragments A3 and C3, and so on. Thus, each set of nine fragments was designed not only to anneal to adjacent fragments of its parent VEGF-A/VEGF-C molecule, but also to anneal to adjacent fragments of the other molecule.
Assembly of chimeric (hybrid) VEGF molecules Assembly of the 9 VEGF-A and 9 VEGF-C DNA fiagments into hybrid DNAs containing regions from both VEGF-A and VEGF-C was accomplished by ligating different combinations of the VEGF-A and VEGF-C DNA fiagments. All DNA fi-agments were isolated after digestion with appropriate restriction enzymes and gel electrophoresis using Qiaex II beads (Qiagen). It will be apparent that, if the proper order of fragments is preserved, the nine VEGF-A fi-agments and the nine 8-92- VEGF-C fragments can be recombined and annealed into 512 distinct hybrids, two of O which represent naturally-occurring sequences (Al-A2-A3-A4-A5-A6-A7-A8-A9 and 0 C1-C2-C3-C4-C5-C6-C7-C8-C9) and 510 of which represent novel hybrids. All 512 sequences were reconstructed using the following three step process.
First, the receptor binding domains of VEGF-A and VEGF-C were divided into 4 subdomains designated N123, N45, C67 and C89, as shown in Figure 2. N123 consists of the first 3 DNA fragments encoding the receptor binding domain of both VEGF-A and VEGF-C. N45, C67 and C89 each consists of 2 DNA fiagments where N45 includes fragments 4 and 5, C67 consists of fragments 6 and 7, and C89 includes fiagIents 8 and 1 10 9.
Continuous DNA's corresponding to the N123 region were constructed by ligating fragments 1, 2, and 3 from either VEGF-A or VEGF-C, thus producing a total of eight possible different N123 DNA segments shown schematically in Figure 3. Similarly, continuous DNAs corresponding to the N45, C67, and C89 regions were constructed by ligating the two appropriate DNA fragments from VEGF-A or VEGF-C. In these cases, all four possible different molecules were produced for each of the regions. Figure 4 is a schematic diagram illustrating all four possible N45 DNA segments, Figure 5 depicts all four possible C67 DNA segments, and Figure 6 shows all four possible C89 DNA segments. All of these molecules were cloned into the multiple cloning site of the pKO- Scrambler-V912-BX vector (Lexicon Genetics Inc.) as part of the ligation reaction. All ligations were carried out by combining 8 nmol/il of vector cut with the appropriate restriction enzyme that enables cloning of the inserts into the vector, and dephosphorylated; 80 nmol/. each of DNA fragments that are to be inserted into the vector, and 5 Weiss Units ofT4 DNA ligase in 50 mM Tris/HCI, 10 mM MgCI 2 10 1mM DTT, 1 mM ATP, 25 pg/ml BSA, and 5% PEG-4000, pH 7.5, followed by incubation for 12 hours at 16'C. Figures 7A-7D depict the amino acid sequences encoded by each of fragments AI-A9 and C1-C9; and schematically depict all the permutations of encoded peptides that result fiom recombinations that form the eight N123 constructs (Fig 7A), four N45 constructs (Fig. 7B), four C67 constructs (Fig. 7C), and four C89 constructs (Fig. 7D).
ND 93 N In the second step, the N123 fragments were joined with N45 fragments, and the SC67 fragments were joined with C89 fragments. The N123 and N45 fragments were Z removed from their pKO-Scrambler-V912 host vector by digestion with restriction Senzymes that allowed ligation of N123 to N45, and which also achieved removal of the non-protein coding regions of fragments 3 and 4 (see Tables 1A, B, 2A and 2B). By ligating each of the eight different N123 regions to all four possible N45 regions, 32 distinct N-terminal portions of the receptor binding domains were obtained. These clones were further inserted into the pSecTagI vector (SEQ ID NO 41). The pSecTagl vector is a combined E. co/i/mammalian expression vector which was constructed by 10 modifying the pSecTagA vector (Invitrogen). pSecTagA was modified to eliminate Sspecific restriction sites using site-directed mutagenesis and synthetic linkers, and the EM7 promoters from pICZa-a (Invitrogen) and pTRACER-CMV were added downstream to the CMV promoter of pSecTagA. Both pSecTagl and it's parent vector, pSecTagA, allow high level of expression in mammalian cell culture using suitable cell lines e. 293T cells, zeocin selection of stably transfected mammalian cells, contain a mammalian signal peptide for secretion of the expressed protein, and contain a Cterminal myc epitope and polyhistidine tag for detection, quantitation and purification of the expressed protein. The pSecTagI vector differs from the pSpecTagA vector in that expression in E. coli is constitutive and modification of the restriction sites facilitated cloning of the hybrid constructs.
The C67 and C89 fragments were removed from their pKO-Scrambler-V912 host vector by digestion with appropriate restriction enzymes, which also achieved removal of the non-protein coding regions of fragments 6 and 9 (see Tables IA, 1B, 2A and 2B). Ligation of the four different C67 molecules to the four different C89 molecules produced 16 distinct C-terminal halves of the receptor binding domain. The C67-C89 fragments were cloned into the pKO-Scrambler vector during these ligations.
Finally, 512 final ligations that combined the 32 different N-terminal portions and the 16 distinct C-tenninal regions resulted in a total of 512 distinct molecules of which 510 are hybrids composed of both VEGF-A and VEGF-C amino acid residues. During this step the 512 constructs were cloned into the pSecTagl vector which contained the 32 different N-terminal 94 portions. The remaining 2 molecules correspond to the original VEGF-A and VEGF-C sequences encoding the receptor binding domain. The predicted nucleotide and amino acid sequences for all 5 12 hybrid molecules are set forth in the sequence listing as summarized in Table Table
VEGF-A/VEGF-C*
Chimera
AAAA.AAAAA
CAAAAAAA-A
A CAAAAAA-A
CCAAAAAAA
AA CAAAAA-A
CACAAAA-AA
ACCAAAAAA
CCCAAAAAA
AAACAAAAA
CAACAAAAA
ACACAAAA-A
CCACAAAAA
AACCAAAAA
CACCAAAAA
ACCCAAAAA
CCCCAAAAA
AAAACAAAA
CAAACAAAA
ACAACAAAA
CCAACAAAA
AACACAAAA
CACACAAAA
ACCACAAAA
CCCACAAAA
AAACCAAAA
CAACCAAAA
ACACCAAAA
CCACCAAAA
AACCCAAA-A
CACCCAAAA
ACCCCAAAA
Predicted DNA Sequence Seq ID NO: 176 178 180 182 184 186 188 190 192 194 196 198 200 202 204 206 208 210 212 214 216 218 220 222 224 226 228 230 232 234 236 Predicted Protein Sequence Seq ID NO: 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 94A CCCCCAAAA 238 239 0AAAAACAAA 240 241 ZCAA-AACAAA 242 243 __ACAAACAAA 244 245 CCAAACAAA 246 247 AACAACAA-A 248 249 CACAACAAA 250 251 ACCAACAAA 252 253 CCCAACAAA 254 255 CIAAACACAAA 256 257 CAACACAAA 258 259 ACACACAAA 260 261 CCACACAAA 262 263 AACCACAJA 264 265 CACCACAAA 266 267 ACCCACAAA 268 269 CCCCACAAA 270 271 AAAACCAAA 272 273 CAAACCAAA 274 275 ACAACCAAA 276 277 CCAACCAAA 278 279 AACACCAAA 280 281 CACACCAAA 282 283 ACCACCAAA 284 285 CCCACCAAA 286 287 AAACCCAAA 288 289 CAACCCAAA 290 291 ACACCCAAA 292 293 CCACCCAAA 294 295 AACCCCAAA 296 297 CACCCCAAA 298 299 ACCCCCAAA 300 301 CCCCCCAAA 302 303 AAAAAACAA 304 305 CAAAAACAA 306 307 ACAA.AACAA 308 309 CCAAAACAA 310 311 AACAAACAA 312 313 CACAAACAA 314 315 ACCAAACAA 316 317 IND 94B CCCAAACAA 318 319 2 AAACAACAA 320 321 0 CACAACA.A 322 323 __CCACAACA-A 326 327 AACCAACAA 328 329 CACCAACA-A 330 331 ACCCAACAA 332 333 CCCCAACAA 334 335 AAAACACAA 336 337 CAAACACAA 338 339 ACAACACAA 340 341 CCAACACAA 342 343 AAACC-N34 4 AACACACA-A 344 345 ACACACAA 346 347 CCCACACAA 350 351 AA-ACCACA-A 352 353 CAACCACA-A 354 355 ACAGCACA-A 356 357 CCACCACAA 358 359 AACCCACA-A 360 361 CACCCACA-A 362 363 ACCCCACA-A 364 365 CGCCCACAA 366 367 AAAAACCAA 368 369 CAAAACCAA 370 371 ACAAACCAA 372 373 CGAAACCAA 374 375 AACAACCAA 376 377 CACAACCAA 378 379 ACCAACCAA 380 381 CCCAACCAA 382 383 AAACACCAA 384 385 CAACACCAA 386 387 ACACACCAA 388 389 CCACACCAA 390 391 AACCACCAA 392 393 CACCACCAA 394 395 ACCCACCAA 396 397 94C CCCCACCAA 398 399 AAAACCCAA 400 401 0CAAACCCAA 402 403 ZACAACCCAA 404 405 __CCAACCCA.A 406 407 AACACCCAA 408 409 CACACCCAA 410 411 ACCACCCAA 412 413 CCCACCCAA 414 415 AAACCCCAA 416 417 CACCCA41 1 INDCCA41 1 ACACCCCA-A 420 421 CCACCCCAA 422 423 AACCCCCAA 424 425 CACCCCCAA 426 427 ACCCCCCAA 428 429 CCCCCCCAA 430 431 AAAAAAACA 432 433 CAAAAAACA 434 435 ACAAAAACA 436 437 CCAAAAACA 438 439 AACAAAACA 440 441 CACAAAACA 442 443 ACCAAAACA 444 445 CCCAAAACA 446 447 AAACAAACA 448 449 CAACAAACA 450 451 ACACAAACA 452 453 CCACAAACA 454 455 AAGCAAACA 456 457 CACCAAACA 458 459 ACCCAAACA 460 461 CCCCAAACA 462 463 AAAACAACA 464 465 CAAACAACA 466 467 ACAACAACA 468 469 CCAACAACA 470 471 AACACAACA 472 473 CACACAACA 474 475 ACCACAACA 476 477 94D CCCACAACA 478 479 AAACCAACA 480 481 0CAACCAACA 482 483 ZACACCAACA 484 485 __CCACCAACA 486 487 AACCCAACA 488 489 CACCCAACA 490 491 krACCCCAACA 492 493 CCCCCCAACA 494 495 AAAAACACA 496 497 CAAAACACA 498 499 ACAAACACA 500 501 CCAAACACA 502 503 AA A CA A50 0 AACAACACA 504 505 ACAACACA 506 507 CCCAACACA 510 511 AAACACACA 512 513 CAACACACA 514 515 ACACACACA 516 517 CCACACACA 518 519 AACCACACA 520 521 CACCACACA 522 523 ACCCACACA 524 525 CCCCACACA 526 527 AAAACCACA 528 529 CAAACCACA 530 531 ACAACCACA 532 533 CCAACCACA 534 535 AACACCACA 536 537 CACACCACA 538 539 ACCACCACA 540 541 CCCACCACA 542 543 AAACCCACA 544 545 CAACCCACA 546 547 ACACCCACA 548 549 CCACCCACA 550 551 AACCCCACA 552 553 CACCCCACA 554 555 ACCCCCACA 556 557 94E CCCCCCACA 558 559 AAAAAACCA 560 561 0CAAAAACCA 562 563 ZACAAAACCA 564 565 CCAAAACCA 566 567 AACAAACCA 568 569 CACAAACCA 570 571 ACCAAACCA 572 573 CCCAAACCA 574 5 AAACAACCA 576 577 CAACAACCA 578 579 ACACAACCA 580 581 CCACAACCA 582 583 AACCAACCA 584 585 CACCAACCA 586 587 ACCCAACCA 588 589 CCCCAACCA 590 591 AAAACACCA 592 593 CAAACACCA 594 595 ACAACACCA 596 597 CCAAGACCA 598 599 AACACACCA 600 601 CACACACCA 602 603 ACCACACCA 604 605 CCCACACCA 606 607 AAACCACCA 608 609 CAACCACCA 610 611 ACACCACCA 612 613 CCACCACCA 614 615 AACCCACCA 616 617 CACCCACCA 618 619 ACCCCACCA 620 621 CCCCCACCA 622 623 AAAAACCCA 624 625 CAAAACCCA 626 627 ACAAACCCA 628 629 CCAAACCCA 630 631 AACAACCCA 632 633 CACAACCCA 634 635 ACCAACQCA 636 637 94F CCCAACCCA 638 639 A A C C C A6 4 4 AAACACCCA 640 641 0 CACACCCA 642 643 __CCACACGCA 646 647 A-ACCACCCA 648 649 CACCACCCA 650 651 ACCCACCCA 652 653 CCCCACCCA 654 655 AAAACCCCA 656 657 CAAACCCCA 658 659 ACAACCCCA 660 661 CCAACCCCA 662 663 A A A C C A6 6 6 AACACCCCA 664 665 ACACCCCA 666 667 CCCACCCCA 670 671 AAACCCCCA 672 673 CAACCCCCA 674 675 ACACCCCCA 676 677 CCACCCCCA 678 679 AACCCCCCA 680 681 CACCCCCCA 682 683 ACCCCCCCA 684 685 CCCCCCCCA 686 687 AAAAAAAAC 688 689 CAAAAAAAC 690 691 ACAAAAAAC 692 693 CCAAAAAAC 694 695 AACAAAAAC 696 697 CACAAAAAC 698 699 ACCAAAAAC 700 701 CCCAAAAAC 702 703 AAACAAAAC 704 705 CAACAAAAC 706 707 ACACAAAAC 708 709 CCACAAAAC 710 711 AACCAAAAC 712 713 CACI2AAAAC 714 715 ACCCAAAAC 716 717 94G NCCCCAAAAC 718 719 >-AAAACAAAC 720 721 0CAAACAAAC 722 723 ZACAACAAAC 724 725 CCAACAAAC 726 727 AACACAAAC 728 729 CACACAAAC 730 731 ACCACAAAC 732 733 CCCACAAAC 734 735 m~f AAACCAAAC 736 737 (N CACA 3 3 INDAAC73 3 ACACCAAAC 740 741 CCACCAAAC 742 743 AACCCAAAC 744 745 CACCCAAAC 746 747 ACCCCAAAC 748 749 CCCCCAAAC 750 751 AAAAACAAC 752 753 CAAAACAAC 754 755 ACAAACAAC 756 757 CCAAACAAC 758 759 AACAACAAC 760 761 CACAACAAC 762 763 ACCAACAAC 764 765 CCCAACAAC 766 767 AAACACAAC 768 769 CAACACAAC 770 771 ACACACAAC 772 773 CCACACAAC 774 775 AACCACAAC 776 777 CACCACAAC 778 779 ACCCACAAC 780 781 CCCCACAAC 782 783 AAAACCAAC 784 785 CAAACCAAC 786 787 ACA-ACCAAC 788 789 CCAACCAAC 790 791 AACACCAAC 792 793 CACACCAAC 794 795 ACCACCAAC 796 797 94H CCCACCAAC 798 799 AAACCCAAC 800 801 0CAACCCAAC 802 803 ZACACCCAAC 804 805 __CCACCCAAC 806 807 AACCCCAAC 808 809 CACCCCAAC 810 811 ACCCCCAAC 812 813 CCCCCCAAC 814 815 AAAAAACAC 816 817 CAAAAACAC 818 819 ACAAA.ACAC 820 821 CGAAAACAC 822 823 AACAAACAC 824 825 CACAAACAC 826 827 ACCAAACAC 828 829 CCCAAACAC 830 831 AAACAACAC 832 833 CAACAACAC 834 835 ACACAACAC 836 837 CCAGAACAC 838 839 AACCAACAC 840 841 CACCAACAC 842 843 AGCCAACAC 844 845 CCCCAACAC 846 847 AAAACACAC 848 849 CAAACACAC 850 851 ACAACACAC 852 853 CCAACACAC 854 855 AAGACACAC 856 857 CACACACAC 858 859 ACCACACAC 860 861 CCCACACAC 862 863 A-AACCACAC 864 865 CAACCACAC 866 867 ACACCACAC 868 869 CCACCACAC 870 871 AACCCACAC 872 873 CACCCACAC 874 875 ACCCCACAC 876 877 941 CCCCCACAC 878 879 AAAAACCAC 880 881 0CAAAACCAC 882 883 ZACAAACCAC 884 885 CCAAACCAC 886 887 AACAACCAC 888 889 CACAACCAC 890 891 ACCAACCAC 892 893 CCCAACCAC 894 895 AAACACCAC 896 897 CAACACCAC 898 899 ACACACCAC 900 901 CCACACCAC 902 903 AACCACCAC 904 905 CACCACCAC 906 907 ACCCACCAC 908 909 CCCCACCAC 910 911 AAAACCCAC 912 913 CAAACCCAC 914 915 ACAACCCAC 916 917 CCAACCCAC 918 919 AACACCCAC 920 921 CACACCCAC 922 923 ACCACCCAC 924 925 CCCACCCAC 926 927 AAACCCCAC 928 929 CAACCCCAC 930 931 ACACCCCAC 932 933 CCACCCCAC 934 935 AACCCCCAC 936 937 CACCCCCAC 938 939 ACCCCCCAC 940 941 CCCCCCCAC 942 943 AAAAAAACC 944 945 CAAAAAACC 946 947 ACAAAAACC 948 949 CCAAAAACC 950 951 AACAAAACC 952 953 CACAAAACC 954 955 ACCAAAACC 956 957 94J CCCAAAACC 958 959 AAACAAACC 960 961 0CAACAAACC 962 963 ZACACAAACC 964 965 __CCAGAAACC 966 967 AACCAAACC 968 969 CACCAAACC 970 971 ACCCAAACC 972 973 CCCCAAACC 974 975 AAAACAACC 976 977 CAAACAACC 978 979 ACAACAACC 980 981 CCAACAACC 982 983 (iAACACAACC 984 985 CACACAACC 986 987 ACCACAACC 988 989 CCCACAACC 990 991 AAACCAACC 992 993 CAACCAACC 994 995 ACACCAACC 996 997 CCACCAACC 998 999 AACCCAACC 1000 1001 GACCCAACC 1002 1003 ACCCCAACC 1004 1005 CCCCCAACC 1006 1007 AAAAACACC 1008 1009 CAAAACACC 1010 .1011 ACAAACACC 1012 1013 CCAAACACC 1014 1015 AACAACACC 1016 1017 CACAACACC 1018 1019 ACCAAGACC 1020 1021 CCCAACACC 1022 1023 AAACACACC 1024 1025 CAACACACC 1026 1027 ACACACACC 1028 1029 CCACACACC 1030 1031 AACCACACC 1032 1033 CACCACACC 1034 1035 ACCCACACC 1036 1037 94K CCCCACACC 1038 1039 AAAACCACC 1040 1041 0CAAACCACC 1042 1043 ZACAACCACC 1044 1045 CCAACCACC 1046 1047 AACACCACC 1048 1049 CACACCACC 1050 1051 ACCACCACC 1052 1053 CCCACCACC 1054 1055 AAACCCACC 1056 1057 CAACCCACC 1058 1059 ACACCCACC 1060 1061 CCACCCACC 1062 1063 AACCCCACC 1064 1065 CACCCCACC 1066 1067 ACCCCCACC 1068 1069 CCCCCCACC 1070 1071 AAAAAACCC 1072 1073 CAAAAACCC 1074 1075 ACAAAACCC 1076 1077 CCAAAACCC 1078 1079 AACAAACCC 1080 1081 CACAAACCC 1082 1083 ACCAAACCC 1084 1085 CCCAAACCC 1086 1087 AAACAACCC 1088 1089 CAACAACCC 1090 1091 ACACAACCC 1092 1093 CCACAACCC 1094 1095 AACCAACCC 1096 1097 CACCAACCC 1098 1099 ACCCAACCC 1100 1101 CCCCAACCC 1102 1103 AAAACACCC 1104 1105 CAAACACCC 1106 1107 ACAACACCC 1108 1109 CCAACACGC 1110 1111 AACACACCC 1112 1113 CACACACCC 1114 1115 ACCACACCC 1116 1117 94L CCCACACCC 1118 1119 A A C A C C1 2 01 2 AAACCACCC 1120 1121 0 CACCACCC 1122 1123 __CCACCACCC 1126 1127 AACCCACCC 1128 1129 CACCCACCC 1130 1131 ACCCCACCC 1132 1133 CCCCCACCC 1134 1135 AAAAACCCC 1136 1137 (iCAAAACCCC 1138 1139 ACAAACCCC 1140 1141 CCAAACCCC 1142 1143 (iAACAACCCC 1144 1145 CACAACCCC 1146 1147 ACCAACCCC 1148 1149 CCCAACCCC 1150 1151 AAACACCCC 1152 1153 CAACACCCC 1154 1155 ACACACCCC 1156 1157 CCACACCCC 1158 1159 AACCACCCC 1160 1161 CACCACCCC 1162 1163 ACCCACCCC 1164 1165 CCCCACCCC 1166 1167 AAA-ACCCCC 1168 1169 CAAACCCCC 1170 1171 ACAACCCCC 1172 1173 CCAACCCCC 1174 1175 AACACCCCC 1176 1177 CACACCCCC 1178 1179 ACCACCCCC 1180 1181 CCCACCCCC 1182 1183 AAACCCCCC 1184 1185 CAACCCCCC 1186 1187 ACACCCCCC 1188 1189 CCACCCCCC 1190 1191 AACCCCCCC 1192 1193 CACCCCCCC 1194 1195 ACCCCCCCC 1196 1197 94M CCCCCCCCC 1198 1199 0 *Construct nomenclature is identical to nomenclature of Table 3.
O Assembly of the hybrid molecules can also be accomplished in fewer ligation steps than outlined above. For example, ligation of N123, N45, C67 and C89 can be completed in a single ligation reaction. By designing fragments with cohesive ends that are perfect complements only with cohesive ends of adjacent fragments, it is possible to I ligate multiple fragments in a correct order in a single ligation reaction.
4D SExample 2 Expression of the hybrid molecules Each of the 512 constructs were separately transfected transiently into 293T cells to express the different hybrid constructs. 293T cells were grown according to standard protocols in medium consisting of Dulbecco's modified Eagle's medium (D- MEM), and 10% fetal bovine serum (FBS). Twenty-four hours prior to transfection, confluent dishes were diluted 1 10 with fresh media into 6 wells. Four hours prior to transfection, the medium was changed. For each construct, 3 ug of DNA was transfected using standard protocols for calcium phosphate-mediated transfection [Sambrook et al., Molecular Cloning A Laboratory Manual pp. 16. 33-16. 36 (1989)].
Twenty hours post-transfection, cells were washed twice with warm PBS and 2 ml of medium was added to each well.
Initial experiments were conducted to determine if the transfected cells were expressing the hybrid VEGF polypeptides encoded by the hybrid DNA molecules.
Thus, 48 hours post-transfection, metabolic labeling with 35 S-methionine and cysteine was initiated using 1. 3 ml/well of labeling medium composed of MEM deficient for cysteine and methionine, 0. 1% BSA, 24 gCi 35 S-methionine-cysteine/ml (Redivue PRO-MIX, Amersham). The cell supematant was harvested 72-78 hours posttransfection, cleared by centrifugation, and stored at 4 0
C.
The supernatant was immunoprecipitated with anti-pentahistidine antibody (Qiagen) by mixing 175 pl of sample supematant with 100 pl IP mix (PBS with 1. BSA, 0. 05% Tween 20, and 12 gl/ml anti-pentahistidine antibody) at 4 0 C overnight, with agitation. (The pSecTag I expression vector was engineered to express each of the hybrid VEGF proteins with a polyhistidine tag.) To collect immunoprecipitated protein, gl of
ID
a 30% protein A sepharose (PAS, Pharmacia) slurry in PBS was added and incubated >0 O under agitation for at least 1.5 hr at 4 C. Standard buffer was added to each immunoprecipitation sample and boiled for 5 minutes at 95 C during which the inimunopreciptated proteins become dissociated from the protein A sepharose. After centrifugation, 10 p. of each sample was analyzed on 15% SDS-PAGE under reducing conditions. The gels were dried and exposed for either 12 hours on phosphoriniager plates or 4 weeks on X-ray film. Results of these experiments are shown in Table 3 CK below, in the column marked "EXP" for expression. As shown in the table with "Yes", Sinutial attempts to express the vast majority of the hybrid constructs were successful.
N 10 Constructs for which weak and no expression ("none") were observed in preliminary studies also are indicated. The failure to achieve expression in initial studies is reported for completeness, and not intended to reflect a conclusion of non-viability or other identified problems. However, it is noteworthythat of the non-expressed constructs, ahnost all were those chimeric molecules in which fragment 3 was derived from VEGF-A and fragment 7 was derived from VEGF-C. Analysis of the physical relationship between these two fragments shows that residues from these two fiagments barely contact each other at the atomic level as judged fiom the VEGF-A crystal stnucture. The incompatibility of fragment 3 fiom VEGF-A and fragment 7 from VEGF-C may arise from incorrect folding of the molecule, perhaps caused in part by rapid glycosylation of the VEGF-C-derived fragment 7 when the molecule appears in the endoplasmic reticulum. The glycosylation sites within VEGF-A are located at a distance from the receptor binding domain, whereas the glycosylation sites within VEGF-C are positioned closer towards the region of the molecule formed by fragment 3 that is predicted to form contacts with the third domain of the receptor. The carbohydrate residues may also be involved in the interaction between ligand and receptor.
Example 3 Binding assays of hybrid molecules to soluble VEGF receptor-Fc fusion proteins.
The hybrid proteins that were expressed in 293T cells (see Example 2 and Table 1) were tested for the ability to bind soluble VEGF receptor-Fc fusion proteins. Binding of the hybrid proteins to all three VEGF receptors, VEGFR-1, VEGFR-2, and VEGFR-3,
IO
-96was analyzed in this manner. Exemplary binding assays have been described in Achen et Z .ol, Proc Nad Acad Sci USA 95:548-53 (1998), incorporated by reference in its entirety.
It will be appreciated that binding assays can be performed with any form of naturally occun-ing VEGF receptors that retain the ability to bind their respective ligands, including but not limited to whole cells that naturally express a receptor or that have been recombinantly modified to express the receptor; truncated, solublized extracellular ligand t' binding domains of receptors; fusions comprising receptor extracellular domains fused to other proteins such as alkaline phosphatase VEGFR-2-AP described in Cao et al., J Biol. Chem. 271:3154-62 (1996)) or immunoglobulin sequences; and fusions comprising CN 10 receptor extracellular domains fused to tag sequences a polyhistidine tag) useful for capturing the protein with an antibody or with a solid support; and receptor extracellular domains chemically attached to solid supports such as CNBr-activated Sepharose beads.
For the present experiments, receptor binding was assayed using constructs comprising the extracellular domain of VEGFR-1, VEGFR-2, or VEGFR-3 fused to immunoglobulin constant region chains. The first three Ig domains of VEGFR-1 were fused to the Fc fragment from the Signal-pIgPlus vector (Ingenius/Novagen/R&D Systems). This construct (VEGFR-I-Fc) was stably expressed in Drosophila Schneider 2 (S2) cells, and puified using Protein A sepharose. Purity was analyzed by silver staining of a PAGE gel and the functionality of the fusion protein was tested by its ability to bind "S-labeled VEGF protein. The VEGFR-2-Fc receptor comprises the first 3 Ig domains of VEGFR-2 (encoded by nucleotides 64-972 of GenBank Ace. No. X61656) fused to the Fc fragment in the pig vector. The VEGFR-3-Fc receptor similarly consists if the first three Ig domains of VEGFR-3 (encoded by nucleotides 20-1005 of GenBank Ace. No.
X68203) fused to the Fc fragment of the pig vector. VEGFR-2-Fc and VEGFR-3-Fc proteins were expressed in 293T cells and purified as described above for VEGFR-1-Fc.
The binding assay procedure was identical to the immunoprecipitation using pentahistidine antibody described in Example 2, apart from the composition of the immunoprecipitation (IP) mixes. The IP mixes used for the receptor binding analysis were as follows: For VEGFR-1 binding assays, the IP mix was phosphate buffered saline (PBS) containing 1.5% BSA, 0.06% Tween 20, 3 ipg/ml heparin and 400 ng/ml VEGFR-1-Fc fusion protein (100 pl1 of this IP mix was added to 200 p.1 of sample
IO
-97supematant); for VEGFR-2 binding assays, the IP inix was 82% conditioned cell O isupernatant from 293T cells transiently expressing VEGFR-2-Fc fusion protein in mixture with 18% of a PBS solution that contained 5% BSA, 0.2% Tween 20, and 10 p g/ml heparin (250 p.l of IP mix was added to 200 pl of sample supematant); and for VEGFR-3 binding assays, the IP mix was 82% conditioned cell supematant from 293T cells transiently expressing VEGFR-3-Fc fusion protein, 18% of PBS containing 5% BSA, t)n 0.2% Tween 20, and 10 jlg/ml heparin (250 t.l of IP mix was added to 200 l of samplc l supematant). A few selected constructs (clones 12-1, 12-5, 12-7, 12-9, 12-11, 12-13, 12- 14, 14-9, 23-1, 32-14, 52-15, 53-3, 82-7, 82-9, 82-11, 82-13, 83-15, 84-9, and 84-11) were CK 10 examined more than one time.
Results fiom the binding assays using 3 5 S labeled hybrid proteins are summarized in Table 3 below. The apparent molecular weights of the detected proteins were between 18 and 27 kD. Usually two bands were visible with different band intensities.
Sometimes, the second band was only detectable after long exposures. The presence of two bands correlates with the origin of fragment 7 and 9 of the hybnd protein being examined. Fragment 7 contains a potential N-glycosylation site irrespective of whether it was derived 6fom VEGF-A or VEGF-C, whereas fragment 9 only contains an Nglycosylation site if it originated fiom VEGF-C. Thus, the multiple bands are likely due to differential glycosylation of the hybrid protein being analyzed. The following are predicted bands for different combinations of glycosylation sites: fragment 7 derived fiom VEGF-A and fiagment 9 from VEGF-A produces two bands of- 18 and 22 kD fragment 7 derived from VEGF-A and fragment 9 from VEGF-C produces an 26 kD band (a second band of- 22 kD is sometimes missing, a third extremely weak band of- 18 kD is sometimes visible) fragment 7 derived from VEGF-C and fragment 9 from VEGF-A produces an 22 kD band (a second band of 18 kD is sometimes missing) fragment 7 derived from VEGF-C and fragment 9 from VEGF-C produces one band of 23 kD.
Results of the binding assays indicate that if both glycosylation sites were derived from VEGF-C, less heterogeneous glycosylation is observed. Molecules containing both
ID
-98- Sfagment 7 from VEGF-A and fragment 9 fiom VEGF-C appear to promote artificial
O
z hyperglycosylation. The VEGF-A glycosylation site contained in fiagment 7 is also prone to incomplete glycosylation The binding assay data indicate that several of the hybrid molecules exhibit novel binding properties. Although the analysis was not quantitative, some of the hybrid molecules show different relative signal strengths. For example, clone 72-10 appears to have lost much of its affinity for VEGFR-3 while retaining most of its affinity for VEGFR-2. These results suggest that among the hybrid proteins that retained the receptor 0 specificities of either parent protein (VEGF-A or VEGF-C), some may have undergone C 10 differential changes in their binding affinities towards the corresponding receptors.
In Table 3 below, column 1 lists the names of the constructs examined. Colunm 2 sequentially lists the 9 fragments of each construct, where A=fragment from VEGF-A, and C=fragment from VEGF-C. Column 3 labeled "EXP" lists the results firom the experiments to express the constructs in 293T cells, as described in Example 2. In this column, "none" indicates that no detectable protein was expressed; "weak" indicates that weak expression was detectable; and "yes" indicates that the expressed protein was readily detectable. The final three colums list results fiom the receptor binding assays described in Example 3, where binding to VEGFR-1-Fc; VEGFR-2-Fc; and VEGFR-3-Fc were examined. For these last three columns, "yes" indicates binding, "none" indicates no detectable binding to the receptor, and indicates that this construct was not expressed in 293T cells, thus, could not be used for binding assays.
Table 3 Results of hybrid molecule expression and receptor binding analysis EXP VEGFR-1 VEGFR-2 VEGFR-3 31-1 ACAAAAAAA yes none none none 31-5 ACAAAACAA none 0 0 0 31-13 ACAAACCAA none 0 0 0 31-9 ACAAACAAA yes none none none 31-2 ACAAAAAAC yes none none none 31-10 ACAAACAAC yes none none none 31-6 ACAAAACAC yes none 31-14 31-12 31-11 31-7 31-4 31-8 31-3 31-15 31-16 21-1 21-2 21-3 21-4 21-5 21-6 21-7 21-8 21-9 21-10 21-11 21-12 21-13 21-14 21-15 21-16 22-1 22-2 22-3 22-4 22-5 22-6 22-7 22-8 22-9 22-10 22-11 22-12
ACAAACCAC
ACAAACACA
ACAAACACA
ACAAAACCA
ACAAAAACC
ACAAAACCC
ACAAAAA CA
ACAAACCCA
ACAAACCCC
CCCAAAAAA
CCCAAACAA
CCCAACAAA
CCCAACCAA
CCCAAAAAC
CCCAAACAC
CCCAACAAC
CCCAACCAC
CCCAAAACA
CCCAAACCA
CCCAACACA
CCCAACCCA
CCCAAAACC
CCCAAACCC
CCCAACACC
CCCAACCC
CCCCCAAAA
CCCCCACAA
CCCCCAAA
CCCCCCCAA
CCCCCAAAC
CCCCCACAC
CCCCCCAAC
CCCCCCCAC
CCCCCAACA
CCCCCACCA
CCCCCCACA
CCCCCCCCA
nolne yes yes nolne yes yes yes none none yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes 0 none nlone 0 none 0 noine 0 0 none none none none none none nolne none none none none none none none none none none none none none none none none none none none none none none none 0 none none 0 0 0 0 none none none none none yes none yes none yes none yes none nonyes none oyes none none none none nonse none noyes none yes yes none yes ilO0le none 0 none 11011C 0 none 0 none 0 0 none nole none none none none none none none none none none none none none none none yes yes yes none yes none yes none yes lnone yes
O
O
O
(N
0
Z
0 1-1 in)
O
in -100- 22-13 22-14 22-15 22-16 72-1 72-2 72-3 72-4 72-5 10 72-6 72-7 72-8 72-9 72-10 72-11 72-12 72-13 72-14 72-15 72-16 11-1 11-2 11-3 11-4 11-5 11-6 11-7 11-8 11-9 11-10 11-11 11-12 11-13 11-14 11-15 11-16 12-1 12-2
CCCCCAACC
CCCCCACCC
CCCCCCACC
CCCCCCCC
ACCCCAAAA
ACCCCACAA
ACCCCCAAA
ACCCCCCAA
ACCCCAAAC
ACCCCACAC
ACCCCCAAC
ACCCCCCAC
ACCCCAACA
ACCCCACCA
ACCCCCACA
ACCCCCCCA
ACCCCAACC
ACCCCACCC
ACCCCCACC
ACCCCCCCC
AAAAAAAAA
AAAAACAA
AAAAACAAA
AAAAACCAA
AAAAAAAAC
AAAAAACAC
AAAAACAAC
AAAAACCAC
AAAAAAACA
AAAAAACCA
AAAAACACA
AAAAACCCA
AAAAAAACC
AAAAAACCC
AAAAACACC
AAAAACCC
AAACCAAAA
AAACCACAA
yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes none yes none yes none yes none yes none yes none yes none yes none yes none none none none none none none none none none none none none none none none none none none none none yes 0 yes 0 yes 0 yes 0 yes 0 yes 0 yes 0 yes 0 none nolle yes 0 yes yes yes yes yes yes yes 0 yes 0 none yes none yes none yes none yes none none none yes none yes none yes none yes none yes yes 0 yes 0 yes 0 yes 0 none 0 yes 0 none 0 yes 0 yes 0 yes none yes none yes none yes none yes none yes none yes none yes none yes none 0 none 0 none 0 none 0 none 0 none 0 none 0 none 0 yes 0 -101- 12-3 12-4 12-5 12-6 12-7 12-8 12-9 12-10 12-11 12-12 12-13 12-14 12-15 12-16 81-1 81-2 81-3 81-4 81-5 81-6 81-7 81-8 81-9 81-10 81-11 81-12 81-13 81-14 81-15 81-16 13-1 13-2 13-3 13-4 13-5 13-6 13-7 13-8
AAACCCAAA
AAACCCCAA
AAACCAAAC
AAACCACAC
AAACCCAAC
AAACCCCAC
AAACCAACA
AAACCACCA
AAACCCACA
AAACCCCCA
AAACCAACC
AAACCACCC
AAACCCACC
AAACCCCCC
CAAAAAAAA
CAAAAACAA
CAAAACAAA
CAAAACCAA
CAAAAAAAC
CAAAAACAC
CAAAA CAAC
CAAAACCAC
CAAAAAACA
CAAAAACCA
CAAAACACA
CAAAACCCA
CAAAAAACC
CAAAAACCC
CAAAACACC
CAAAACCCC
AAAACAAAA
AAAACACAA
AAAACCAAA
AAAACCCAA
AAAACAAAC
AAAACACAC
AAAACCAAC
AAAACCCAC
yes yes none 0 yes none yes none yes yes yes yes yes none yes none yes none yes none yes none yes none yes none yes none yes none none yes .yes yes yes yes yes 0 yes 0 yes none none none yes 0 yes 0 yes 0 yes 0 yes 0 yes 0 yes 0 yes 0 yes 0 0 none yes none yes none yes 0 none 0 yes 0 none 0 yes 0 none none yes none yes 0 yes 0 yes 0 yes 0 none 0 U yes 0 none 0 yes 0 yes 0 0 none yes none yes none none 0 none 0 yes 0 yes 0 yes 0 yes yes yes yes none 0 none 0 none 0 none 0 none 0 none 0 none 0 none none 0 0 none none none none -102- 13-9 13-10 13-11 13-12 13-13 13-14 13-15 13-16 14-1 14-2 14-3 14-4 14-5 14-6 14-7 14-8 14-9 14-10 14-11 14-12 14-13 14-14 14-15 14-16 23-1 23-2 23-3 23-4 23-5 23-6 23-7 23-8 23-9 23-10 23-11 23-12 23-13 23-14
AAAACAACA
AAAACACCA
AAAACCACA
AAAACCCCA
AAAACAACC
AAAACACCC
AAAACCAC C
AAAACCCCC
AAACAAAAA
AAACAACAA
AAACACAAA
AAACACCAA
AAACAAAAC
AAACAACAC
AAACACAAC
AAACACCAC
AAACAAACA
AAACAACCA
AAACACACA
AAACACCCA
AAACAAACC
AAACAACCC
AAACACACC
AAACACCCC
CCCACAAAA
CCCACACAA
CCCACCAAA
CCCACCCAA
CCCACAAAC
CCCACACAC
CCCACCAAC
CCCACCCAC
CCCACAACA
CCCACACCA
CCCACCACA
CCCACCCCA
CCCACAACC
CCCACACCC
yes none yes none yes yes yes Inole yes none yes none yes none yes nolne yes none none none yes none yes none yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes 0 yes 0 yes none yes 0 yes 0 yes 0 yes 0 none 0 yes 0 0 0 none 0 none 0 none none none none none none none none none none none none none none none 0 none 0 none none none 0 none 0 yes 0 none 0 yes 0 yes 0 .0 0 none 0 none 0 none none none none none none none none none yes none yes none yes none 0 none 0 none none none 0 inone 0 none 0 none 0 none 0 yes 0 0 0 none 0 none 0 none none none none none none none none none none none none none none 23-15 0 23-16 z 33-1 33-2 33 33-4 )36 33-9 33-10 33-S1 33-12 t 33-13 33-14 33-15 33-16 34-1 34-2 34-3 34-4 34-5 34-6 34-7 34-8 34-9 34-10 34-1 1 34-12 34-13 34-14 34-15 34-16 41-1 41-2 41-3 41-4 -103-
CCCACCACC
LCCACCCCC
ACAACAAAA
ACAACACAA
ACAACCAAA
A CAACC CA A
ACAACAAAC
A C AACACAC
ACAACCAAC
A CAACCCAC
ACAACAACA
ACAACACCA
ACAACCACA
ACAACCCCA
ACAACAACC
ACAACACCC
ACAACCACC
ACAACCCCC
ACACAAAAA
ACACAACAA
ACACACAAA
A CACACCAA
ACACAAAAC
ACACAACAC
ACACACAAC
ACACACCAC
ACACAAACA
ACACAACCA
ACACACACA
ACACACCCA
ACACAAACC
ACACAACCC
ACACACACC
ACACACCCC
CACAAAAAA
CACAAACAA
CACAACAAA
CACAACCAA
yes yes yes yes ycs yes yes yeS yes yes yes 1one yes none yes yes yes yes yes 'lone yes none yes none yes none yes none yes none yes yes yes none yes none yes none Olulle liolic Dolle flone liolle nolle nlone nlone liolle nione Tiolle o none 0 11011C lolle none none none 0 Iolte
O
none o none 0 nole none 0 none nole none 0 yes 0 none 0 n1o1e rionie yes liolic yes nione none nione I)OIlC nonle yes 0 none 0 nione ione none none none 0 110 IC 0 none 0 none 0 none 0 none 0 none none none 0 none 0 nione 0 110)e none none liolic nIs0e nonel none none none none none 0 none 0 none none none none none 0 none 0 none 0 none 0 none 0 none 0 none none none 0 none 0 none 0 41-5 0 41-6 41-7 41-8 41-9 41-10 41-1 41-13 D 10 41-14 41-15 41-16 42-1 42-2 42-3 42-4 42-5 42-6 42-7 42-9 42-9 42-10 42-11 42-12 42-13 42-14 42-15 42-16 43-1 43-2 43-3 43-4 43-5 43-6 43-7 43-8 43-9 43-10 -104-
CACAAAAAC
CACAANCAC
CACAACAAC
CACAACCAC
CACAAAACA
CACAAACCA
CACAACACA
CACAACCCA
CACAAAACC
C A CAAACCC C ACAACACC
CACAACCCC
CACCCAAAA
CACCCACAA
CACCCCAAA
CACCCCCAA
CACCCAAAC
CACCCACAC
CACCCCAAC
CACCCCCAC
CACCCAACA
CACCCACCA
CACCCCACA
CACCCCCCA
CACCCAACC
CACCCACCC
CACCCCACC
CACCCCCCC
CACACAAAA
CACACACAA
CACACCAAA
CACACCCAA
CACACAAAC
CACACACAC
CACACCAAC
CACACCCAC
CACACAACA
CACACACCA
yes yes yes 11011C yes none yes nole yes yes yes yes yes none yes none none yes yes yes yes yes yes yes yes yes yes yes yes none yes none yes yes yes yes yes none lonle 11011 "iole 0 'ole 0 11011C 0 none none nione ilone none 0 DoIle 0 0 nonle none 110110 none none none none none none none none yes 0 nonie 0 none none none none none 0 nole none none 0 0 nione "Oe none none none Tiolle 0 none 0 0 none none none none none none none none none none none none 0 none 0 none none none none none 0 11011C 'lone 1one 0 none 0 none
U
f11oe nione 'lone 11Olle none 0 none 0 0 none nolle I1011 none none none none none none none none none 0 none 0 none none none none IOnO 0
O
O
o, 0
Z
0 1
O
o,1 -105- 43-11 43-12 43-13 43-14 43-15 43-16 44-1 44-2 44-3 10 44-4 44-5 44-6 44-7 44-8 44-9 44-10 44-1 1 44-12 44-13 44-14 44-15 44-16 54-1 54-2 54-3 54-4 54-5 54-6 54-7 54-8 54-9 54-10 54-11 54-12 54-13 54-14 54-15 54-16
CACACCACA
CACACCCCA
CACACAACC
CACACACCC
CACACCACC
CACACCCC
CACCAAAAA
CACCAACAA
CACCACAAA
CACCACCAA
CACCAAAAC
CACCAACAC
CACCACAAC
CACCACCAC
CACCAAACA
CACCAACCA
CACCACACA
CACCACCCA
CACCAAACC
CACCAACCC
CACCACACC
CACCACCCC
CCACAAAAA
CCACAACAA
CCACACAAA
CCACACCAA
CCACAAAAC
CCACAACAC
CCACACAAC
CCACACCAC
CCACAAACA
CCACAACCA
CCACACACA
CCACACCCA
CCACAAACC
CCACAACCC
CCACACACC
CCACACCCC
yes none yes yes yes yes yes yes yes yes yes none yes yes yes yes yes yes yes yes yes yes yes none yes none yes none yes none yes yes yes none yes none yes none none lOl1 0 none none none none none none 0 0 C 0 1 none nolle none nollne 0 none none none none nolle none none lione none none none 0 none 0 none 0 none 0 none 0 none 0 none 0 none none none none nonle none none none none 0 none none nolne ollne none none none none none none none 0 none 0 none 0 none 0 none none none 0 none 0 none 0 none 0 none none none none none none none none none 0 none none none none none none none none none none none 0 none 0 none 0 none 0 none none 0 none 0 none 0
O
O
O
-106- 64-1 64-2 64-3 64-4 64-5 64-6 64-7 64-8 64-9 64-10 64-11 64-12 64-13 64-14 64-15 64-16 83-1 83-2 83-3 83-4 83-5 83-6 83-7 83-8 83-9 83-10 83-11 83-12 83-13 83-14 83-15 83-16 24-1 24-2 24-3 24-4 24-5 24-6
AACCAAAAA
AACCAACAA
AACCACAAA
AACCACCAA
AACCAAAAC
AACCAACAC
AACCACAAC
AACCACCAC
AACCAAACA
AACCAACCA
AACCACACA
AACCACCCA
AACCAAACC
AACCAACCC
AACCACACC
AACCACCCC
CAAACAAAA
CAAACACAA
CAAACCAAA
CAAACCCAA
CAAACAAAC
CAAACACAC
CAAACCAAC
CAAACCCAC
CAAACAACA
CAAACACCA
CAAACCACA
CAAACCCCA
CAAACAACC
CAAACACCC
CAAACCACC
CAAACCCCC
CCCCAAAAA
CCCCAACAA
CCCCACAAA
CCCCACCAA
CCCCAAAAC
CCCCAACAC
yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes none yes none yes yes yes none yes none yes none yes none yes none yes yes yes yes yes yes none none nolne none nlone none none none none nione none none none none none none oyes none none none yes 0 yes 0 yes none yes 0 yes 0 yes 0 yes 0 yes 0 none none none none none none none none none none none none none none none none none none none none none yes 0 yes 0 yes none yes 0 none 0 yes 0 none 0 yes 0 none none none none none none none none none nlone none none none none none none none none none none none none none 0 0 none none none 0 none 0 none 0 none 0 none 0 none none none none none none -107- 24-7 0 24-8 24-9 24-10 24-11 mI 21-12 1 21-13 1~ 24-14 24-15 M 10 24-16 32-1 C1 32-2 32-3 32-4 32-5 32-6 32-7 32-8 32-9 32-10 32-11 32-12 32-13 32-14 32-15 32-16 51-1 51-2 51-3 51-4 51-5 51-6 51-7 51-8 51-9 51-10 51-11 51-12
CCCCACAAC
CCCCACCAC
CCCCAAACA
CCCCAACCA
CCCCACACA
CCCCACCCA
CCCCAAACC
CCCCAACCC
CCCCACACC
CCCCACCCC
ACACCAAAA
ACACCACAA
ACACCCAAA
ACACCCCAA
ACACCAAAC
ACACCACAC
ACACCCAAC
ACACCCCAC
ACACCAACA
ACACCACCA
ACACCCACA
ACACCCCCA
ACACCAACC
ACCACACCC
ACACCCACC
ACACCCCCC
CCAAAAAAA
CCAAAACAA
CCAAACAAA
CCAAACCAA
CCAAAAAAC
CCAAAACAC
CCAAACAAC
CCAAACCAC
CCAAAAACA
CCAAAACCA
CCAAACACA
CCAAACCCA
yes yes yes yes yes yes yes yes yes yes yes none yes none yes yes yes yes yes none yes none yes yes yes yes yes yes yes yes yes yes yes yes yes none yes none none nolne Ilone none none none none none none none none 0 none 0 none none none none none 0 none 0 none none none none none none none none none none none none none 0 none 0 0 none none none none none none none none none none 0 none 0 none none none none none 0 none none 0 none none none none none none none none nolle none none none nolle 0 none 0 none none none none none none none none none none 0 none none none none none yes 0 yes 0 none yes yes yes none none none none none none none none none 0 none 0 -108- 51-13 51-14 51-15 51-16 52-1 52-2 52-3 52-4 52-5 52-6 52-7 52-8 52-9 52-10 52-11 52-12 52-13 52-14 52-15 52-16 53-1 53-2 53-3 53-4 53-5 53-6 53-7 53-8 53-9 53-10 53-11 53-12 53-13 53-14 53-15 53-16 61-1 61-2
CCAAAAACC
CCAAAACCC
CCAAACACC
CCAAACCCC
CCACCAAAA
CCACCACAA
CCACCCAAA
CCACCCCAA
CCACCAAAC
CCACCACAC
CCACCCAAC
CCACCCCAC
CCACCAACA
CCACCACCA
CCACCCACA
CCACCCCCA
CCACCAACC
CCACCACCC
CCACCCACC
CCACCCCCC
CCAACAAAA
CCAACACAA
CCAACCAAA
CCAACCCAA
CCAACAAAC
CCAACACAC
CCAACCAAC
CCAACCCAC
CCAACAACA
CCAACACCA
CCAACCACA
CCAACCCCA
CCAACAACC
CCAACACCC
CCAACCACC
CCAACCCCC
AACAAAAAA
AACAAACAA
yes yes yes none yes none yes none yes yes yes yes yes none yes none none yes yes yes yes none yes none yes yes yes yes yes none yes none yes yes yes yes yes yes none nlone 0 none 0 none 0 none none none none none 0 0 0 none none none 0 yes 0 none none none none none 0 none 0 none none none none yes none none none none 0 none 0 none 0 none none none none none onne 0 none 0 0 none none yes yes 0 yes 0 none none yes none none 0 none 0 none none none none none none none none none 0 none 0 none 0 none none none none yes 0 yes 0 0 yes yes yes none 0 yes 0 none none none none none 0 none 0 none none none none none none -109- 61-3 O 61-4 61-5 61-6 61-7 61-8 61-9 tr 61-10 61-11 10 61-12 61-13 61-14 61-15 61-16 62-1 62-2 62-3 62-4 62-5 62-6 62-7 62-8 62-9 62-10 62-11 62-12 62-13 62-14 62-15 62-16 63-1 63-2 63-3 63-4 63-5 63-6 63-7 63-8
AACAACAAA
AACAACCAA
AACAAAAAC
AACAAACAC
AACAACAAC
AACAACCAC
AACAAAACA
AACAAACCA
AACAACACA
AACAACCCA
AACAAAACC
AACAAACCC
AACAACACC
AACAACCCC
AACCCAAAA
AACCCACAA
AACCCCAAA
AACCCCCAA
AACCCAAAC
AACCCACAC
AACCCCAAC
AACCCCCAC
AACCCAACA
AACCCACCA
AACCCCACA
AACCCCCCA
AACCCAACC
A'A CCCACCC
AACCCCACC
AACCCCCCC
AACACAAAA
AACACACAA
AACACCAAA
AACACCCAA
AACACAAAC
AACACACAC
AACACCAAC
AACACCCAC
yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes none yes none yes yes yes yes yes none none none none none none none none none none none none none yes 0 none none none none none none none none none none none none none none yes 0 none 0 none none none none none none none none none none none none none none none Rlle none none none none none none none none none none yes 0 none nonyes yes none yes none none yes none none nonee yes 0 yes 0 none yes yes none none none none none none none liolle none none none none nollne none none none none 0 none none none none none none none none yes none none none none none none 0 none 0 none none yes none -110- 63-9 63-10 63-11 63-12 63-13 63-14 63-15 63-16 71-1 71-2 71-3 71-4 71-5 71-6 71-7 71-8 71-9 71-10 71-11 71-12 71-13 71-14 71-15 71-16 73-1 73-2 73-3 73-4 73-5 73-6 73-7 73-8 73-9 73-10 73-11 73-12 73-13
AACACAACA
AACACACCA
AACACCACA
AACACCCCA
AACACAACC
AACACACCC
AACACCACC
AACACCCCC
ACCAAAAAA
ACCAAACAA
ACCAACAAA
ACCAACCAA
ACCAAAAAC
ACCAAACAC
ACCAACAAC
ACCAACCAC
ACCAAAACA
ACCAAACCA
ACCAACACA
ACCAACCCA
ACCAAAACC
ACCAAACCC
ACCAACACC
ACCAACCCC
ACCACAAAA
ACCACACAA
ACCACCAAA
ACCACCCAA
ACCACAAAC
ACCACACAC
ACCACCAAC
ACCACCCAC
ACCACAACA
ACCACACCA
ACCACCACA
ACCACCCCA
ACCACAACC
none none none 0 none none none none nolne none none none none none none none none none none none none none none none none none none 0 none none none none none none none none none none none none 0 none none none none none none none none none none none none none none none none none none none none none none none 0 none none yes none none none none none none nolle none none none 0 none none none none none none none none none none none none none none none none none none none none none none none 0 none Ilone none none none none none none none none none 73-14 ACCACACCC yes none none none -111-
O
O
8^ i', 73-15 73-16 74-1 74-2 74-3 74-4 74-.5 74-6 74-7 10 74-8 74-9 74-10 74-11 74-12 74-13 74-14 74-15 74-16 82-1 82-2 82-3 82-4 82-5 82-6 82-7 82-8 82-9 82-10 82-11 82-12 82-13 82-14 82-15 82-16 84-1 84-2 84-3 84-4
ACCACCACC
ACCACCCCC
ACCCAAAAA
ACCCAACAA
ACCCACAAA
ACCCACCAA
ACCCAAAAC
ACCCAACAC
ACCCACAAC
ACCCACCAC
ACCCAAACA
ACCCAACCA
ACCCACACA
ACCCACCCA
ACCCAAACC
ACCCAACCC
ACCCACACC
ACCCACCCC
CAACCAAAA
CAACCACAA
CAACCCAAA
CAACCCCAA
CAACCAAAC
CAACCACAC
CAACCCAAC
CAACCCCAC
CAACCAACA
CAACCACCA
CAACCCACA
CAACCCCA
CAACCAACC
CAACCACCC
CAACCCACC
CAACCCCCC
CAACAAAA
CAACAACAA
CAACACAAA
CAACACCAA
yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes yes none yes none yes none yes none yes none yes none yes yes yes yes yes none yes none none none none none none none none none none none none none none none none none none none none none none none niolle yes 0 yes 0 yes Rolle nolle 0 nyes 0 nyes none none none none yes 0 none yes 0 yes 0 yes 0 yes none none none yes 0 yes 0 yes no1ne lnone Ione none none none none none yes none yes nolne yes ione none none none none nolne none none none 0 yes 0 yes 0 yes 0 none none yes none none 0 yes 0 none none llll none none none none none none none none nolle none none none none none none none none none none none none none 0 yes 0 yes 0 yes 0 yes yes yes yes none 0 none 0
O
-112- 84-5 C A A A A AA C yes yes none none O 84-6 CAACAACAC none 0 0 0 84-7 CAACACAAC yes none none none 84-8 CAACACCAC none 0 0 0 84-9 CAACAAACA yes yes yes yes i, 84-10 CAACAACCA none 0 0 0 84-11 CAACACACA yes yes yes yes i) 84-12 CAACACCCA none 0 0 0 84-13 CAACAAACC none 0 0 0 O 10 84-14 CAACAACCC none 0 0 0 84-15 CAACACACC none 0 0 0 84-16 CAACACCCC none 0 0 0 Receptor binding properties were analyzed only for constructs that were expressed. fa clone was weakly expressed, its receptor binding properties were analyzed only if its size allowed distinction from endogenous VEGF-A expression, or if its amino acid composition allowed removal of endogenous VEGF-A using monoclonal anti-VEGF-A antibodies (R&D Systems) prior to assaying receptor binding. Although the epitope recognized by-this anti-VEGF-A antibody has not been characterized, our preliminary results indicate that the epitope is located within one or more of fiagments 2, 3, 4, 7, or 9 of VEGF-A. Thus, antibody precipitation of endogenous VEGF-A was performed for all constructs in which fragments 2, 3, 4, 7, and 9 were derived from VEGF-C. Further mapping of the epitope of this antibody may allow similar examination of additional constructs. For example, if subsequent analysis indicates that the epitope does not reside in fragment 2, constructs in which fragment 2 was derived fiom VEGF-A can also be analyzed by this method. This procedure was performed for binding to VEGFR-1 or VEGFR-2, to assess how many low affinity binding hybrid molecules were not detected due to interference with endogenous VEGF. Failure to detect a signal or detection of a weak signal in the receptor binding assays does not conclusively demonstrate lack of or low receptor binding affinity. The intrinsic set-up of the experiment does not allow detection of low affinity binders of VEGFR-1 and VEGFR-2 that are weakly expressed. Thus, the binding assays may have failed to detect low affinity -113binders of VEGFR-l and VEGFR-2 for some of the hybrid proteins that were weakly 0 expressed.
In this assay, apparent low receptor binding affinity of a low-level-expressed hybrid molecule could be clue to heterodimerization with endogenous VEGF. For example, if a hybrid protein has no receptor-affinity itself, but is able to dimerize with endogenous VEGF-A, such a heterodimer may he capable of binding one of more receptor(s) with low i laffinity. Purification of chimeric polypeptides of the invention using iimunoaffinity Schromatography with an antibody that recognizes either the )lmyc or H-A tag sequences) and Susing the purified polypeptide in receptor binding assays will resolve any ambiguities Cl 10 caused by endogenous VEGF-A in conditioned media. Alternatively, the hybrid proteins will be expressed in insect cells, S9 cells, to avoid contamination with endogenous
VEGF-A.
Lack of expression or low level expression of a particular construct may be due to properties of the hybrid protein itself, variations in DNA quality, or may reflect mutations in the DNA acquired during construction of the hybrid clone. In the present case, all constructs were sequenced after the first ligation step, and selected clones were sequenced after the second ligation step. Analysis of these sequences indicated that no mutations occurred during the first step, and none of the sequences examined after the second step of construction contained mutations. Thus, any mutations present in the final clone most probably occurred during the final ligation step.
Thirty-six of the 512 clones were sequenced to detennine the frequency with which constructs acquired mutations during construction of the clones that resulted in changes at the amino acid level. The constructs that were sequenced were clones 11-1 (SEQ ID NOS: 42-43), 11-16 (SEQ ID NOS: 44-45), 22-1 (SEQ ID NOS: 46-47), 22-16 (SEQ ID NOS: 48-49), 12-1 to 12-16 (SEQ ID NOS: 50-81), and 31-1 to 31-16 (SEQ ID NOS: 82-113). Only 2 of the 36 clones, 12-13 and 12-16, showed a deviation from the expected sequence. Clone 12-16 had undergone a loss of two base pairs at the ligation junction between N45 and C67, resulting in a fiameshift mutation after the RCG triplet of fragment C5 and a stop codon only a few codons thereafter. Clone 12-13 had acquired a point mutation which results in the substitution of Asp by Asn at the last C-terminal amino acid of this hybrid protein.
IO
S-114- From the 512 hybrid constructs examined, four were chosen for further analysis Z including sequencing to determine if any mutations occurred during construction of the Shybrid protein and repetition of binding assays to confirm initial results. Results fiorn binding assays of these four particular hybrid proteins: constructs 12-13, 12-11, 12-9, and tn 5 12-7 indicate that they show novel binding patterns that are not exhibited by known VEGF receptor ligands. 12-9 and 12-13 show binding to VEGFR-1 and VEGFR-3 but Cc not VEGFR-2, whereas 12-7 and 12-11 exhibit binding to all three VEGF receptors.
0 These results show that it is possible by combinatoial approaches to provide VEGF-related growth factors having modified properties. The novel molecules constructed in some cases have been shown to have modified biological effects compared to their wild-type ancestors, and thus may be used in applications where specificity and fine-tuning of biological effects are necessary. In particular, these experiments demonstrate that it is possible to construct a "super-VEGF", such as clones 12-7 and 12- 11, which binds all three luown VEGFRs, and therefore should be uniquely potent m inducing vascular growth.
Example 4 Examination of VEGF-A and VEGF-C receptor binding epitopes The VEGF-A/VEGF-C hybrid proteins can be used to examine interactions between VEGF-A or VEGF-C, and their receptors. Analysis of the results fiom the receptor binding assays, such as those described in Table 3 and Example 3, enable careful investigation of the receptor-binding epitopes of these two VEGF growth factors. The ability of particular hybrid proteins to bind one of the VEGF receptors may be correlated with the presence of one or more particular fragments derived from one of the parent molecules. Such data can help define the amino acid residues important for binding to a specific VEGF receptor. Knowledge of the precise receptor binding epitopes of a particular VEGF protein can facilitate the design of inhibitory molecules useful for therapeutic purposes.
Twenty-one VEGF residues important for interfacing with VEGFR-1 are indicated in large bold text: IN 115 cN GQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCG GCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEcRP Z KKD (SEQ ID NO: 1209) Data from the chimera experiments indicates that those residues from fragment 2, which corresponds to the N-tenninal helix and residues from fragment 7, which corresponds to strand 35 appear particularly important for conferring VEGFRt specificity. Figure 8 is a three-dimensional model of the interaction of a VEGF-A cI dimer with two VEGFR-1 molecules. The two VEGF-A monomers are colored in green IO 10 and blue, respectively. Domain 2 of the two VEGFR-1 receptors are depicted in gray.
SRed represents the location of residues within me VEGF-A monomers important for VEGFR-1 interfacing. These residues are clustered at the two ends of the VEGF dimer and include the Nterminal helix and part of the p5 strand.
The corresponding twenty-one residues in VEGF-C that would analogously be involved in interfacing VEGFR-3 are indicated below in large bold text
AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFK
PPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFA
NHTSCRcMSKLD (SEQ ID NO: 1210) Interestingly, analysis of the receptor binding patterns from the chimera experiments indicates that a VEGF-C-derived fragment 4 (containing the P2 strand of the molecule) is absolutely required for VEGFR-3 binding specificity. Fragments 5 (which includes the p3 strand) and 8 appear to represent two other important VEGF-C fragments for VEGFR-3 binding. The amino acid sequence of VEGF-C fragments 4 and 5 is EFGVATNTFFKPPCVSVYRCG (SEQ ID NO: 1205). The TNTFxxxP quintet of residues (SEQ ID NO: 1204) is particularly noteworthy because these residues are conserved in human, quail, and bovine VEGF-C and human VEGF-D, all of which bind VEGFR-3. The analogous residues in human VEGF-A, which does not bind VEGFR-3, differ: IEYIxxxS (SEQ ID NO: 1211). Figure 10 is a three-dimensional model
IND
O
-116of a the interaction between portions of a VEGF-C dimer and a single VEGFR-3
O
Z molecule, extrapolated fi-om the VEGF-A/VEGFR-1 model. Blue and green represent the 0 two VEGF-C monomers and grey represents VEGFR-3. Fragment 5 of the green VEGF- C monomer is shown in orange and fragment 4 of the same monomer is shown in white.
Residues in red are those located within fiagment 4 or 5 that are probably in contact with the receptor.
Figure 9 is a three-dimensional model that depicts the groove formed by the C1 O fiagments that appear to be important for VEGFR-3 specificity. This groove is speculated to accommodate the linker region between domain 2 and 3 of the VEGFR-3 receptor.
The ently and the sides of this groove are formed by the fragments that appear to be important for conferring VEGFR-3 specificity. The green and blue indicate the two VEGF-C monomers and the gray indicates the VEGFR-3 receptor molecule. The VEGF- C residues that are believed to participate in binding VEGFR-3 are indicated in yellow.
Although fragments 6 and 9 are involved in interaction with the VEGF receptors, these fragments do not appear to be involved in determining receptor specificity.
Example Analysis of receptor activation or inhibition by the hybrid VEGF proteins The VEGF-A/VEGF-C hybrid proteins may be used for therapeutic applications where either activation of inhibition of one or more VEGF receptors is desired. For example, a candidate hybrid protein can be added to stable cell lines expressing a particular VEGF receptor whose activation is necessary for cell survival. Survival of the cell line indicates that the candidate hybrid protein is able to bind and activate that particular VEGF receptor. On the other hand, death of the cell line indicates that the candidate hybrid protein fails to activate the receptor. Exemplary examples of such cellsurvival assays have been described in International Patent Publication No. WO 98/07832 and in Achen et al, Proc Natl Acad Sci USA 95:548-553 (1998), incorporated herein by reference. This assay employs Ba/F3-NYK-EpoR cells, which are Ba/F3 pre-B cells that have been transfected with a plasmid encoding a chimeric receptor consisting of the extracellular domain of VEGFR-2 and the cytoplasmic domain of the erythropoietin receptor (EpoR). These cells are routinely passaged in interleukin-3 (1L-3) and will die in
IO
0-117the absence of I-3. However, if signaling is induced from the cytoplasmic domain of the 0 Z chimeric receptor, these cells survive and proliferate in the absence of L-3. Such 0 signaling is induced by ligands which bind to the VEGFR-2 extracellular domain of the chimeric receptor. For example, binding of VEGF-A or VEGF-D to the VEGFR-2 in 5 extracellular domain causes the cells to survive and proliferate in the absence ofIL-3.
Parental Ba/F3 cells which lack the chimeric receptor are not induced by either VEGF-A or VEGF-D to proliferate in the absence of IL-3, indicating that the responses of the OBa/F3-NYK-EpoR cells to these ligands are totally dependent on the chimeric receptor.
SCandidate hybrid proteins can be tested for binding to the VEGFR-2 extracellular 10 domain and subsequent activation of the chimeric receptor by assaying cell survival in the absence of IL-3. On the other hand, hybrid proteins that interfere with the binding of VEGFR-2 ligands, such as VEGF-A or VEGF-D, to the extracellular domain, or with the activation of the cytoplasmic domain, will cause cell death in the absence of L-3.
Cells are cultured in the presence of IL-3 until required, then washed three times in phosphate buffered saline (PBS), resuspended in IL-3-free cell culture medium (Dulbecco's Modified Eagle's Medium (DMEM) supplemented with fetal calf serum L-glutamine geneticin mg/ml), streptomycin (100.g/ml) and penicillin and replated in 72-well culture plates (Nunc, Denmark) at a density of approximately 1000 cells/well. To assay for receptor activity, candidate hybrid proteins are added to culture wells at final concentrations of 10 m 1 to 10- 5 M and incubated for 1 hour at 37C in 10% CO 2 For assaying the ability of the candidate hybrid protein to inhibit activation of the VEGFR-2/EpoR receptor, recombinant VEGF-A or VEGF-D is added to the hybrid protein-containing wells at a concentration to produce near-maximal survival of the Ba/F3-NYK-EpoR cells (typically 500ng/ml). Positive control cultures contain either VEGF-A or VEGF-D supernatant alone and negative control cultures contain neither hybrid protein nor growth factor. Cells are then grown in culture for 48 hours, after which time a solution of 3-(3,4-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT; 500.g/ml) is added to the cultures, and incubated for another 30 minutes.
MTT is converted to a blue formazan product by mitochondria, thus staining living cells blue. Surviving blue cells in experiments where either activation (hybrid protein alone) or inhibition (hybrid protein VEGF-A or VEGF-D) was assayed are counted under a -118microscope with inverted optics (100X magnification) and compared to cell survival in Z the positive control (VEGF-A or VEGF-D only) wells. Cell survival is nonnalized such Sthat survival in negative controls is set to 0 (typically no viable cells were seen in negative controls), while survival in positive controls is set to 100% (typically 300-400 cells/well).
5 Data is analyzed by one way analysis of variance (ANOVA), with a Bonferroni multiple comparisons test carried out post-hoc to test for differences between individual c cultures of hybrid protein alone (to assay binding and activation of the receptor), or hybrid
C<
M protein VEGF-A or VEGF-D (to assay inhibition of receptor activation), with VEGF-A or VEGF-D alone (positive control).
Repetition of the same assay using cells transfected with different chimeric receptors VEGFR-3/EpoR) allows screening for activation of different VEGFRs.
VEGFR-2 (KDR) and VEGFR-3 (Flt4) autophosphorvlation assays As an alternative indicator of activity, the ability of a hybrid protein to stimulate autophosphorylation of a particular VEGF receptor can also be examined. A candidate hybrid protein is added to cells expressing a particular VEGF receptor. The cells are then lysed and inmuoprecipitated with anti-VEGF receptor antiserum and analyzed by Western blotting using anti-phosphotyrosine antibodies to determine hybrid proteininduced phosphorylation of the VEGF receptor.
An expression vector comprising a polynucleotide encoding a hybrid VEGF molecule of the invention is transfected into an appropriate host cell 293-EBNA cells using a calcium phosphate transfection method. About 48 hours after transfection, the growth medium of the transfected cells is changed to DMEM medium lacking fetal calf senun) and the cells are incubated for 36 more hours) to provide a conditioned medium. The conditioned medium is collected and centrfifged at 5000 x g for 20 minutes, and the supematant is concentrated.
The concentrated conditioned media is used to stimulate cells expressing a VEGF receptor. For example, PAE-KDR cells (Pajusola et al., Oncogene, 9:3545-55 (1994); Waltenberger et al., J. Biol. Chem., 269:26988-26995 (1994)) are grown in Ham's F12 medium-10% fetal calf serum (FCS), or confluent NIH 3T3 cells expressing VEGFR-3 are grown in DMEM medium. The cells are starved overnight in DMEM medium or
ID
O
-119- Hlam's F12 supplemented with 0.2% bovine serum albumin (BSA), and then incubated for 0 Z 5 minutes with the unconcentratel, 2-fold, 5-fold, and/or 10-fold concentrated conditioned media. Recombinant human VEGF-A or VEGF-C and conditioned media fiom mnocktransfected cells are exemplary controls. In addition to conditional media, purified hybrid polypeptide can be employed in this or other assays described herein.
After stimulation with conditioned media, the cells are washed twice with ice-cold Tris-Buffered Saline (TBS) containing 100 mM sodium orthovanadate and lysed in RIPA c buffer containing 1 mM phenylmethylsulfonyl fluoride (PMSF), 0.1 U/ml aprotinin and 1 SmM sodium orthovanadate. The lysates are sonicated, clarified by centrifugation at C 10 16,000 x g for 20 minutes and incubated for 3-6 hours on ice with 3-5 .1 of antisera specific for VEGFR-3 or VEGFR-2. Immunoprecipitates are bound to protein A-Sepharose, washed three times with R1PA buffer containing InmM PMSF, ImM sodium orthovanadate, washed twice with 10 mM Tris-HCl (pH and subjected to SDS-PAGE using a 7% gel. Polypeptides are transferred to nitrocellulose by Western blotting and analyzed using PY20 phosphotyrosine-specific monoclonal antibodies (Transduction Laboratories) or receptor-specific antiserum and the ECL detection method (Amersham Corp.).
The ability of a hybrid polypeptide to stimulate autophosphorylation (detected using the anti-phosphotyrosine antibodies) is scored as stimulating the receptor. The level of stimulation observed for various concentrations of hybrid polypeptide, relative to known concentrations of VEGF-A or VEGF-C, provide an indication of the potency of receptor stimulation. Polypeptides that have been shown to bind the receptor, but are incapable of stimulating receptor phosphorylation, are scored as inhibitors. Inhibitory activity can be further assayed by mixing a known receptor agonist such as recombinant VEGF-A or VEGF-C with either media alone or with concentrated conditioned media, to determine if the concentrated conditioned media inhibits VEGF-A-mediated or VEGF-Cmediated receptor phosphorylation.
In initial experiments to study tyrosine phosphorylation of VEGFR-2 and VEGFR-3 mediated by selected hybrid molecules which bind VEGFR-2 or VEGFR-3, it was observed that all hybrid proteins tested were able to induce phosphorylation of the receptors, however to a lesser extent than that mediated by VEGF-A or VEGF-C. Further
IO
-120examination of the expression levels of the hybrid proteins in the baculovirus system used Z to produce the proteins indicate that the proteins are not all expressed in comparable Samounts. Differential expression levels of the hybrid proteins may explain some of the lower activities exhibited by these proteins in assaying their ability to stimulate tyrosine tn 5 phosphorylation of VEGFR-2 and VEGFR-3. In addition, the extent of phosphorylation 0 induced by these hybrid molecules detennined using this particular assay may not Mc} correlate with biological activity in vivo.
Example 6 Analysis of receptor binding affinities of hybrid proteins Preliminary analysis of the 512 hybrid proteins indicate that a number of them are able to bind one of more of the VEGFRs. In addition, results fiom these experiments suggest that some show differential binding affinities to one of more VEGFRs. For these experiments, the hybrid protein is expressed in an insect cell system, S9 cells, to eliminate contamination with endogenous VEGF-A found in mammalian cells. To measure the relative binding affinities of selected hybrid proteins, an ELISA-type approach is used. For example, to examine binding affulity for VEGFR-1, serial dilutions of competing VEGFR-1-IgG fusion proteins and a subsaturating concentration of the candidate hybrid protein tagged with the myc epitope is added to microtitre plates coated with VEGFR-1, and incubated until equilibrium is established. The plates are then washed to remove unbound proteins. Hybrid molecules that remain bound to the VEGFR-1 coated plates are detected using an anti-myc antibody conjugated to a readily detectable label horseradish peroxidase. Binding affinities (EC50) can be calculated as the concentration of competing VEGFR-IgG fusion protein that results in half-maximal binding. These values can be compared with those obtained fiom analysis of VEGF-A or VEGF-C to determine changes in binding affinity of one or more of the VEGFRs.
Similarly, binding to VEGFR-2 is accomplished by using a VEGFR-2-IgG fusion protein, and binding to VEGFR-3 is determined using a VEGFR-3-IgG fusion protein.
-121- Example 7 SEndothlelial cell migration ill collagen gel i mediated by VEGF-A/VEGF-C hybrid proteins Both VEGF-A and VEGF-C stimulate endolhelial cell migration in collagen gel.
The hybrid proteins of the invention are examined to determine if they are also capable of stimulating endothelial cell migration in collagen gel, thus providing another indicia of biological activity. Exemplary examples of such cell migration assays have been 1 described in International Patent Publication No. WO 98/33917, incorporated herein by Sreference. Briefly, bovine capillary endothelial cells (BCE) are seeded on top of a K 10 collagen layer in tissue culture plates. Conditioned media from cells transfected with an expression vector producing the candidate hybrid protein is placed in wells made in collagen gel approximately 4mun away from the location of the attached BCE cells. The number of BCE cells that have migrated fiom the original area of attachment in the collagen gel towards the wells containing the hybrid protein is then counted to assess the ability of the hybrid protein to induce cell migration.
BCE cells (Folkman el al., Proc. Natl. Acad. Sci. (USA), 76:5217-5221 (1979)) are cultured as described in Pertovaara et al., J. Biol. Chem., 269:6271-74 (1994).
Collagen gels are prepared by mixing type I collagen stock solution (5 mg/ml in 1 mM HC1) with an equal volume of 2x MEM and 2 volunes of MEM containing 10% newborn calf serum to give a final collagen concentration of 1.25 mg/ml. Tissue culture plates cm diameter) are coated with about 1 mm thick layer of the solution, which is allowed to polymnerize at 37°C. BCE cells are seeded atop this layer.
For the migration assays, the cells are allowed to attach inside a plastic ring (1 cm diameter) placed on top of the first collagen layer. After 30 minutes, the ring is removed and unattached cells are rinsed away. A second layer of collagen and a layer of growth medium newborn calf serum solidified by 0.75% low melting point agar (FMC BioProducts, Rocldand, ME), are added. A well (3 mm diameter) is punched through all the layers on both sides of the cell spot at a distance of 4 mm, and media containing a hybrid VEGF polypeptide (or media alone or media containing VEGF-A or VEGF-C to serve as controls) is pipetted daily into the wells. Photomicrographs of the cells migrating out from the spot edge are taken, after six days, through an Olympus CK 2 inverted microscope equipped with phase-contrast optics. The migrating cells are
IO
0-122counted after nuclear staining with the fluorescent dye bisbenzimide (1 mg/ml, Hoechst 0 Z 33258, Signa).
The number of cells migrating at different distances from the original area of attachment lowards wells containing media conditioned by the non-transfected (control) or t 5 transfected (mock; hybrid; VEGF-C; or VEGF-A) cells are determined 6 days after addition of the media. The number of cells migrating out from the original ring of t' attachment are counted in five adjacent 0.5 mm x 0.5 mm squares using a microscope iO ocular lens grid and 10x magnification with a fluorescence microscope. Cells migrating further than 0.5 mm are counted in a similar way by moving the grid in 0.5 mm steps.
C 10 The ability of a hybrid polypeptide to induce migration of BCE cells in indicative of receptor agonist activity. The number of migrating cells in the presence of a hybrid protein versus a similar concentration of VEGF-A or VEGF-C provides an indication of the potency of agonist activity. Polypeptides that have been shown to bind the receptors expressed on BCE cells, but are incapable of stimulating migration, are scored as potential inhibitors. Inhibitory activity can be further assayed by mixing a lalown receptor agonist such as recombinant VEGF-A or VEGF-C with either media alone or with concentrated conditioned media, to detennine if the concentrated conditioned media inhibits VEGF-Amediated or VEGF-C-mediated BCE migration.
Example 8 Analysis of the ability of hybrid proteins to induce vascular permeability Both VEGF-A and VEGF-C are capable of increasing the penneability of blood vessels. The hybrid proteins of the invention are assayed to determine which of these proteins possess this biological activity and which inhibit it. For example, vascular permeability assays according to Miles and Miles, J. Physiol 118:228-257 (1952), incorporated herein in its entirety, are used to analyze the hybrid proteins. Briefly, following intravenous injection of a vital dye, such as pontamine sky blue, animals such as guinea pigs are injected intradermally with a composition containing the candidate hybrid protein being examined. For controls, media alone or media containing VEGF-A or VEGF-C is injected in the same manner. After a period of time, the accumulation of dye at the injection site on the skin is measured. Those hybrid proteins that increase
IO
-123permeability will result in greater accumulation of dye at the injection site as compared to 0 Z those hybrid proteins that fail to induce vascular penneability.
O In a variation of this assay, hybrid polypeptides that are suspected of being inhibitors of VEGF-A or VEGF-C are fiust mixed with VEGF-A or with VEGF-C at In 5 varying ratios 50:1, 10:1, 5:1, 2:1, 1:1, 1:2, 1:5, 1:10) and the mixtures are injected intradermally into the animals. In this manner, the ability of the hybrid polypeptide to t inhibit VEGF-A-mediated or VEGF-C-mediated vascular permeability is assayed.
c Example 9 O Endothelial Cell Proliferation Assay The mitogenic activity of hybrid proteins can be examined using endothelial cell proliferation assays such as that described in Breier et al., Dev 114:521-532 (1992), incorporated herein in its entirety. The hybrid proteins are expressed in a mammalian cell line COS cells. Culture supernatants are then collected and assayed for mitogenic activity on bovine aortic endothelial (BAE) cells by adding the supematants to the BAE cells. After three days, the cells are dissociated with trypsin and counted using a cytometer to determine any effects of the hybrid protein on the proliferative activity of the BAE cells. As negative controls, DMEM supplemented with 10% FCS and the conditioned media from untransfected COS cells or from COS cells transfected with vector alone can be used. Supematants from cells transfected with constructs expressing proteins that have been shown to induce proliferation of BAE cells VEGF-A) can be used as a positive control.
Example Examination of the ability of hybrid proteins expressed through the human K14 keratin promoter to induce growth of lymphatic vessels in skin of transgenic mice Experiments are conducted in transgenic mice to analyze the specific effects of overexpression of hybrid proteins in tissues. The physiological effects in vivo provide an indication of receptor activation/inhibition profile and an indication of the potential therapeutic action of a hybrid protein. In one variation, the human K14 keratin promoter which is active in the basal cells of stratified squamous epithelia [Vassar et al., Proc. Natl.
Acad. Sci. (USA), 86:1563-1567 (1989)], is used as the expression control element in the -124- >recombinant hybrid protein transgene. The vector containing the K114 keratin promoter is
O
Z described in Vassar el al., Genes Dev., 5:714-727 (1991) and Nelson et al., J Cell Biol.
O 97.-244-251 (1983).
A DNA fragment containing the K14 promoter, hybrid protein cDNA, and Ki14 tr 5 polyadenylation signal is synthesized, isolated, and injected into fertilized oocytes of the FVB-NIH mouse strain. The injected zygotes are transplanted to oviducts of t' pseudopregnant C57BL6 x DBA/2J hybrid mice. The resulting founder mice are then analyzed for the presence of the transgene by polymerase chain reaction of tail DNA using appropriate primers or by Southern analysis.
These transgenic mice are then examined for evidence of angiogenesis or lymphangiogenesis in the skin, such as the lymphangiogenesis seen in transgenic mice that overexpress VEGF-C [see International Publication W098/33917]. Histological examination of K14-VEGF-C transgenic mice showed that in comparison to the skin of wildtype littermates, the dorsal dennis was atrophic and connective tissue was replaced by large lacunae devoid of red cells, but lined with a thin endothelial layer. These distended vessel-like structures resembled those seen in human lymphangiomas. The number of skin adnexal organs and hair follicles were reduced. In the snout region, an increased unmber of vessels was also seen.
Examination of the vessels in the skin of the transgenic mice using antibodies that recognize proteins specific for either blood or lymphatic vessels can further verify the identity of these vessels. Collagen types IV, XVIl [Muragaki et al., Proc. Natl. Acad.
Sci. USA, 92: 8763-8776 (1995)] and laminin are expressed in vascular endothelial cells while desmoplakins I and II (Progen) are expressed in lymphatic endothelial cells. See Schmelz et al., Differentiation, 57: 97-117 (1994).
Example 11 Analysis of hybrid proteins in promoting or inhibiting myelopoiesis Overexpression of VEGF-C in the skin of K14-VEGF-C transgenic mice correlates with a distinct alteration in leukocyte populations [see International Publication W098/33917]. Notably, the measured populations of neutrophils were markedly increased in the transgenic mice. The effects of the hybrid proteins on hematopoiesis can
ID
S-125be analyzed using fluorescence-activated cell sorting analysis using antibodies that Z recognize proteins expressed on specific leukocyte cell populations. Leukocytes Spopulations are analyzed in blood samples taken fiom the Fl transgenic mice described in Example 13, and from their non-transgenic littermnates.
inr Example 12 Effects of hybrid proteins on growth ind differentiation of ihuman CD34+ progenitor cells in vitro SAddition of VEGF-C to cultures of cord blood CD34+ cells induces cell Cl 10 proliferation. Co-culture of GM-CSF, IL-3, GM-CSF IL-3, or GM-CSF SCF with VEGF-C leads to an enhancement of proportions ofmyeloid cells [see International Publication W098/33917]. Hybrid proteins of the invention can also be examined for their ability to induce growth of CD34+ progenitor cells in vitro. Human CD34+ progenitor cells (HPC, 10 x 103) are isolated from bone marrow or cord blood mononuclear cells using the MACS CD34 Progenitor cell Isolation Kit (Miltenyi Biotec, Bergish Gladbach, Germany), according to the instructions of the manufacturer and cultured in RPMI 1640 medium supplemented with L-glutamine (2.5 mM), penicillin (125 IE/ml), streptomycin (125 tig/ml) and pooled 10 umbilical cord blood (CB) plasma at 37 °C in a humidified atmosphere in the presence of 5% CO, for seven days, with or without hybrid protein at concentrations ranging from 10 ng/ml to 1 tig/ml. After seven days, total cell number is evaluated in each culture.
The co-stimulatory effect of hybrid proteins in cultures either supplemented with recombinant human stem cell factor (rhSCF, 20 ng/ml PreproTech, Rocky Hill, NY) alone or a combination of granulocyte macrophage colony stimulating factor (rhGM-CSF, 100 ng/ml, Sandoz, Basel, Switzerland) plus SCF can also be examined. Experiments can also be conducted to analyze the co-stimulatory effects of hybid protein on total cell yields of serum-free cultures of CB CD34+ HPC cells supplemented with either GM-CSF alone, IL-3 (rhIL-3, 100 U/ml, Behring AG, Marburg, Germany) alone; or a combination of GM- CSF plus IL-3.
Cells from the (7 day) plasma-supplemented cultures described above are also analyzed for the expression of the early granulomonocytic marker molecules lysozyme -126- (LZ) and myeloperoxidase (MPO) as well as the lipopolysaccharide (LPS) receptor CD14
O
z using immuInofluorescence.
O In another series of experiments, CD34+ cells are cultured in medium supplemented with 50 ng/ml M-CSF, with or without 100 ng/ml hybrid protein, for seven ln lays. After seven days, the cultures were analyzed to determine the percentages of CD14+ cells and mean fluorescence intensity.
c, Example 13 Analysis of hybrid proteins using CAM assays The choroallantoic membrane (CAM) assay described in Oh et al., Dev Biol 188:96-109 (1997), incorporated herein in its entirety, is a commonly used method to examine the in vivo effects of angiogenic factors. Using this assay, VEGF growth factors including both VEGF-A and VEGF-C have been shown to induce the development of blood vessels [Oh et al., Dev Biol 188:96-109 (1997)]. Thus, this method can be used to study the angiogenic properties of the hybrid proteins.
Briefly, on day 4 of development, a window is cut out into the eggshell of chick or quail eggs. The embryos are checked for nonnal development, the window in the eggshell is sealed with cellotape, and the eggs are incubated until day 13 of development.
Approximately 3.3 p.g of hybrid protein dissolved in 5 pl of distilled water is added to Thermanox coverslips (Nunc, Naperville, IL), which have been cut into disks with diameters of approximately 5 mm, and air dried. Disks without added protein are used as controls. The dried disks are then applied on the chorioallantoic membrane (CAM) of the eggs. After 3 days, the disks are removed and fixed in 3% glutaraldehyde and 2% formaldehyde and rinsed in 0.12 M sodium cacodylate buffer. The fixed specimens are photographed and embedded in Epon resin (Serva, Germany) for semi- (0.75 pm) and ultrathin (70 nm) sectioning. Both semi- and ultrathin sections are cut using an Ultracut S (Leika, Germany). Ultrathins sections are analyzed by an EM 10 (Zeiss, Germany).
Specimens are then analyzed for evidence of growth of new capillaries, which would indicate that the hybrid protein being examined is capable of stimulating angiogenesis.
Example 14
O
-127- Analysis of hono- or betero dimerization O of the VEGF-A/VEGF-C hybrid proteins Activation of tyrosine receptors is commonly mediated by ligandl-induLced receptor dimnerization. Investigation of interactions between VEGF and VEGFR-2 indicate that receptor dimerization is accomplished via ligand dimerization in which both receptors bind parts of each of the two ligand proteins that constitute the homo- or heterodimer.
Mutant VEGF proteins that can bind to VEGER-2 but are unable to dimerize, canIot CN~ activate the receptor [Fub et al., JBiol Cheni 273:11197-11204 (1998)]. All of the VEGF family members are capable of hom-no- and/or heterodimerization. VEGF-A and VEGF-C S 10 fail to heterodinerize with each other. H-owever, some of the VEGF-A/VEGF-C hybrid proteins may dineize with each other or with one or both of the parent molecules. The hybrid proteins may also be capable of homodimerization. The following protocols are designed to identify dimerization capabilities of the hybrid proteins of the invention. A candidate hybrid protein is co-expressed with a different hybrid protein or one of the parent molecules in a cell line 293T or S9 cells. Extracts from these cells are prepared and used for irruniunoprecipitation using an antibody that recognizes only one of the two proteins being examined. The imrnunoprecipitated proteins are then subjected to SDS-PAGE and analyzed. If both proteins are detected on the gel, heterodimerization occurred between the two proteins being examined. On the other hand, if only the protein recognized by the antibody used during imrmunoprcipitation is detected, dimerization failed to occur between the two proteins. Since dimerization appears to be critical for receptor activation, hybrid proteins that bind receptor but February 16, 2000fail to dimerize with self or with natural VEGF growth factors endogenously expressed by cells are expected to be inhibitors of endogenous vascular endothelial growth factor activity.
Heterodimers comprising a polypeptide of the invention with other polypeptides of the invention or with naturally occuwring members of the VEGF family of growth factors may be generated essentially as described in Cao et al., Biol. Chem., 271:3154- 62 (1996). Briefly, a recombinantly produced hybrid polypeptide is mixed at an equiinolar ratio with another recomnbinantly produced polypeptide of interest, such as a VEGF-A, VEGF-B, VEGF-C, VEGF-D, PiGF, PDGFa, PDGFP, or c-fos induced growth factor polypeptide. (See, Collins et al., Nature, 316:748-750 (1985) (PDGF-P, GenlBank Acc. No. X02811); Claesson-Welsh et al., Proc. Natl. Acad. Sci. USA, -128- 86(1 3) :4917-49221 (1989) (PDGF-a, GenLBank Acc. No. M22734); Claesson-Welsh el al., Z Mol. Cell. B~iol. 8:3476-3486 (1988) (PDGF-fl, Geii-anlk Aco. No. MV216 16); Olorsson el al, Pro. Nol. Acad. Sci. (USA), 93:2576-2581 (1996) (VEGF'-B, Denflank Acc. N~o.
U48801I); Maglione et al., Proc. Nrail. Acad. Sci. (USA), 88(20).:9267-927 1 (1996) CPIGF, i' 5 GenBankc Acc. No. X54936); Hleldin et al., Growth Factors, 8:245-252 (1993); Folknian, Nature Mokd., 1:27-31 (1995); Friesel et al., FASEB J, 9:919-25 (1995); Mustonenl et al., J Cell. Biol., 129:895-98 (1995); Orindini, Proc. Nal. Acad. Sci. USA1, 93(21):11675-11680 (1996); and others cited elsewhere herein. The mixed polypeptides are Incubated in [lhe presence Of gUiffidine-HCI and D'FF. The thi*ol groulps are then protected with S-sulfoniation, and the protein is dialy zed overnight, initially against urealglutathione-SH, gluttathione-S-S-gluitathione, and subsequently against 20 mlv Tris-HCI.
The heterodimers are screened to determine their bindiig affinity with respect to receptors of the FPGF/PDGF family (especially VEGFR-l, VEGFR-2, and VEGFR-3), and their ability to stiniulate the receptors assaying for dirner-stimulated receptor phosphorylation in cells expressing the receptor of interest on their srface). The binding assays my be competitive binding assays such as those described herein and in the art. Iii the initial binding assays, recorubinantly produced proteins comprising the extraCellUlar domais of receptors are employable, as described in preceding examples for VEGFR-2 and VEGFR-3. Heterodimers that bind and stimulate receptors are useful as recombinant growth factor polypeptides. Heterodimers that bind but do not stimulate receptors are useful as growth factor antagonists. Hetcrodirners that display agonistic or antagonistic activities in the screening assays are further screened using, endothelial cell migration assays, vascular permecability assays, and in vivo assays. It will also be apparent from the preceding examples that dinners comprising two VEGP-G polypeptides dimers of identical VEGF-C polypeptides as well as dimers of different VEGF-C polypcptides) are advantageously screened for agonistic and antagonistic activities using the samne assays.
Example Determination of biological half-life of the VEGF-AIVEGF-C hybrid proteins
IND
-129- Knowledge of the in vivo biological half-life of a compound is valuable for 0 Z therapeutic applications. Although the biological half-life of the hybrid proteins has not been determined in vivo, preliminary results in vitro indicate that the VEGF-A/VEGF-C hybrid proteins described above exhibit different half-lives. Incubation of cell supernatanis containing specific hybrid proteins at 4"C for approximately two months reveal different protein stabilities for the various hybrid proteins. Examination of the in n vivo biological half-life can be determined by injecting iodine-labeled hybrid protein into C animals. Briefly, 50 Ipg of hybrid protein are iodinated using IODO-GEN (Pierce) O according to the manufacturer's instructions to a specific radioactivity of approximately 2- C 10 10 pCi/Ig protein. The iodinated protein is purified using PD-10 Sephadex (Phan-iacia) according to the manufacturer's instructions. 12-16 week old mice (weighing 20-25 g) are anesthetized with sodiun pentobarbital (1 mg/20 g body weight mouse) during the course of the experiment. 5-10 pmol of the radiolabeled protein diluted in 100 I1l sterile saline are is injected into the tail vein over 30 seconds. At specific time points (1 miin, 2 min, 4 min, 8 min, 15 min, 30 min, 60 min, and 120 min), 40-50 Il of blood is collected by periorbital bleeding or form the tail artery. 25 pl of the plasma fraction of each blood sample is then spotted onto Whatman filter paper, precipitated with 10% trichloroacetic acid (TCA), and rinsed with ethanol. The amount of radiolabeled protein present in the plasma fraction is determined by quantifying the radioactivity using a gamma counter.
Polypeptides that display improved half-life relative to that of naturally occurring VEGFs are a preferred genus ofpolypeptides of the invention. Polypeptides that show 25%, or 100% improvement of half-life to that of naturally occurring VEGFs are highly preferred.
Example 16 Construction of hybrid molecules using other VEGF or PDGF family proteins.
The procedure described in Example 1 can be extended to create hybrid molecules using any of the PDGF/VEGF growth factors. Members of the PDGF/VEGF family, which comprises at least VEGF-A (SEQ ID NOS: 1 and PIGF (SEQ ID NOS: 114 and 115), VEGF-B (SEQ ID NOS: 116 and 117), VEGF-C (SEQ ID NOS: 21 and 22), VEGF-D (SEQ ID NOS: 118 and 119), VEGF-E (SEQ ID NOS: 120 and 121), and I 130 CI NZ2 VEGF (SEQ ID NOS 122 and 123), D1701 VEGF (SEQ IDNOS 150 and O 151); NZ10 VEGF [described in SEQ ID NO 11 of International Patent Application Z PCT/US99/25869, incorporated herein in its entirety] PDGF-A (SEQ ID NO 124 and 125), PDGF-B (SEQ ID NO 126 and 127), and fallotein (SEQ ID NO 148 149) share sufficient homology with each other within the receptor binding domain to permit I designing oligonucleotides with unique cohesive ends as taught in Example I with respect to VEGF-A and VEFG-C. As shown by the successful results in Examples 1-3, t oligonucleotides designed to provide double-stranded fragments having cohesive ends as short as 3-6 bases in length are sufficient to permit successful recombination into C 10 novel hybrid molecules (with very few unintended mutations).
While the presence of cohesive ends greatly facilitated ligation of fragments in a desired order and orientation, it will be appreciated that ligation of fragments can also be accomplished without cohesive ends. Blunt-end fragments also can be synthesized and annealed to generate hybrid proteins using the method described above. With a blunt-end strategy, the nucleotide sequences of the parent molecules do not need to be examined for the presence of nucleotide identity to enable the creation of cohesive ends. However, additional post-ligation screening may be required to identify hybrids that contain fragments in the desired order and orientation.
Using such guidelines, oligonucleotide pairs are designed and annealed as described in Example 1 to provide DNA fragments of the receptor for binding domain of two or more VEGF proteins. Combinatorial ligation of the various DNA fragments produces novel hybrid polypeptides that are screened for receptor binding and for biological properties such as ability to stimulate or inhibit endothelial cell growth and migration and modulate vascular permeability.
Example 17 Generation of hybrid molecules using PCR-driven DNA shuffling.
The following protocol provides an alternative "DNA shuffling" methodology for generating hybrid vascular endothelial growth factor-encoding polynucleotides and polypeptides. DNA shuffling procedures have been described in the literature for enzymes such as antibiotic-resistance-conferring proteins, and a few other protein
O
S-131- Sfamilies. [See, Chang et Nature Biotechnology, 17: 793-797 (1999); Kikuclu el Z al.. Gene, 236: 159-167 (1999); -lHarayama et al., TIB7ECH, 16: 76-82 (1998); Crameri et al., Nature, 391: 288-291 (1998); Patten et al., Curr. Opin. Biotechnology, 8: 724-733 (1997); Zhang et al., Proc. Natl. Acad. Sci. USA, 94: 4504-09 (1997); Stemmer, Proc.
Nail. Accd. Sci. USA, 91: 10747-1074 (1994); and Stemmer, Nature, 370: 389-391 (1994), all incorporated herein by reference in their entirety.] Two or more cDNAs encoding vascular endothelial growth factor polypeptides l iare first cloned and amplified. In a preferred embodiment, only those portions of the cDNAs that encode minimum VEGF receptor-binding domains, and optionally small and 3' additional sequences from the cDNAs, are amplified.
The purified and isolated cDNAs are digested into fragments of about 10-75 base pairs using restriction endonucleases and/or DNaseI, and the fragments of this desired size range are purified and isolated by agarose gel electrophoresis, electroelution, and ethanol precipitation).
The purified and isolated fi-agments from the two or more VEGFs are mixed and subjected to a self-priming polymerase chain reaction to shuffle the fragments in order to form new hybrid molecules. Exemplary PCR protocols are set forth in Kikuchi et al.
(1999) and Stemmer (1994). The annealing temperature in the PCR reactions is adjusted based on the level of sequence identity between the original cDNAs, to assure that annealing ofheterologous sequences containing imperfect matches is possible. After conducting 25-50 cycles of PCR without primers, an aliquot fiom the PCR reaction is selected and used as template for a second round of PCR with primers based on 5' and 3' sequences of the original cDNAs. Preferably, the primers also include restriction endonuclease recognition sequences to facilitate cloning the resultant second-round PCR products into an expression vector.
The resultant clones are ligated into an expression vector and transformed or transected into host cells to express the novel hybrid VEGF polypeptides (if any) encoded thereby. The proteins are screened using receptor binding and/or activity assays as set forth in the preceding examples, to select those clones which encode polypeptides having desirable receptor agonist/antagonist profiles.
IND
O
S-132-
O
Z INDEX FOR SEQUENCE LISTING SSEQ ID NOS: 1 &2 are the nucleotide and amino acid sequences of VEGF-A SEQ ID NOS: 3-11 are VEGF-A forward primers S 5 SEQ ID NOS: 12-20 are VEGF-A reverse primers SEQ ID NOS: 21 22 are the nucleotide and amino acid sequences of VEGF-C SEQ ID NOS: 23-31 are VEGF-C forward primers iO SEQ ID NOS: 32-40 are VEGF-C reverse primers SEQ ID NO: 41 is the nucleotide sequence of pSecTagi SEQ ID NOS: 42 43 are the nucleotide and amino acid sequences of clone 11-1. The VEGF receptor binding domain (derived fiom VEGF-A and VEGF-C) correspond to amino acids 1-102 of SEQ ID NO: 43.
SEQ ID NOS: 44 45 are the nucleotide and amino acid sequences of clone 11-16.
(VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO: SEQ ID NOS: 46 47 are the nucleotide and amino acid sequences of clone 22-1.
(VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: 47) SEQ ID NOS: 48 49 are the nucleotide and amino acid sequences of clone 22-16.
(VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 49) SEQ ID NOS: 50-51 are the nucleotide and amino acid sequences of clone 12-1.
(VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO: 51) SEQ ID NOS: 52-53 are the nucleotide and amino acid sequences of clone 12-2.
(VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO: 53) SEQ ID NOS: 54-55 are the nucleotide and amino acid sequences of clone 12-3.
(VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO: SEQ ID NOS: 56-57 are the nucleotide and amino acid sequences of clone 12-4.
(VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO: 57) SEQ ID NOS: 58-59 are the nucleotide and amino acid sequences of clone 12-5.
(VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO: 59) SEQ ID NOS: 60-61 are the nucleotide and amino acid sequences of clone 12-6.
(VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO: 61) SEQ ID NOS: 62-63 are the nucleotide and amino acid sequences of clone 12-7.
IO
O -133- (VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO: 63) Z SEQ ID NOS: 64-65 are the nucleotide and amino acid sequences of clone 12-8.
O (VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO: SEQ ID NOS: 66-67 are the nucleotide and amino acid sequences of clone 12-9.
(VEGF receptor binding domain= amino acids 1-104 of SEQ )I NO: 67) SSEQ ID NOS: 68-69 are the nucleolide and arnino acid sequences of clone 12-10.
(VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO: 69) SEQ ID NOS: 70-71 are the nucleotide and amino acid sequences of clone 12-11.
Fl (VEGF receptor binding domrain= anino acids 1-104 of SEQ ID NO: 71) SEQ ID NOS: 72-73 are the nucleotide and amino acid sequences of clone 12-12.
(VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO: 73) SEQ ID NOS: 74-75 are the nucleotide and amino acid sequences of clone 12-13.
(VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO: SEQ ID NOS: 76-77 are the nucleotide and amino acid sequences of clone 12-14.
(VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO: 77) SEQ ID NOS: 78-79 are the nucleotide and amino acid sequences of clone 12-15.
(VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO: 79) SEQ ID NOS: 80-81 are the nucleotide and amino acid sequences of clone 12-16.
(VEGF receptor binding domain= amino acids 1-54 of SEQ ID NO: 81) SEQ ID NOS: 82-83 are the nucleotide and anino acid sequences of clone 31-1 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: 83) SEQ ID NOS: 84-85 are the nucleotide and amino acid sequences of clone 31-2 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: SEQ ID NOS: 86-87 are the nucleotide and amino acid sequences of clone 31-3 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: 87) SEQ ID NOS: 88-89 are the nucleotide and amino acid sequences of clone 31-4 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: 89) SEQ ID NOS: 90-91 are the nucleotide and amino acid sequences of clone 31-5 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: 91) SEQ ID NOS: 92-93 are the nucleotide and amino acid sequences of clone 31-6 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: 93)
ID
O
0 -134- SEQ ID NOS: 94-95 are the nucleotide and amino acid sequences of clone 31-7 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: O SEQ ID NOS: 96-97 are the nucleotide and amino acid sequences of clone 31-8 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO: 97) SEQ ID NOS: 98-99 are the nucleotide and amino acid sequences of clone 31-9 (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 99) iy^ SEQ ID NOS: 100-101 are the nucleotide and anino acid sequences of clone 31-10 O (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 101) SEQ ID NOS: 102-103 are the nucleotide and amino acid sequences of clone 3 1-1 (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 103) SEQ ID NOS: 104-105 are the nucleotide and amino acid sequences of clone 31-12 (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 105) SEQ ID NOS: 106-107 are the nucleotide and amino acid sequences of clone 31-13 (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 107) SEQ ID NOS: 108-109 are the nucleotide and amino acid sequences of clone 31-14 (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 109) SEQ ID NOS: 110-111 are the nucleotide and amino acid sequences of clone 31-15 (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 111) SEQ ID NOS: 112-113 are the nucleotide and amino acid sequences of clone 31-16 (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO: 113) SEQ ID NOS: 114 115 are the nucleotide and amino acid sequences of PlGF SEQ ID NOS: 116 117 are the nucleotide and amino acid sequences of VEGF-B SEQ ID NOS: 118 119 are the nucleotide and amino acid sequences of VEGF-D SEQ ID NOS: 120 121 are the nucleotide and amino acid sequences of VEGF-E SEQ ID NOS: 122 123 are the nucleotide and amino acid sequences ofNZ2 VEGF SEQ ID NOS: 124 125 are the nucleotide and amino acid sequences of PDGF-A SEQ ID NOS: 126 127 are the nucleotide and amino acid sequences of PDGF-B SEQ ID NOS: 128-136 are the amino acid sequences of fragments A1-A9 SEQ ID NOS: 137-145 are the amino acid sequences of fragments C1-C9 SEQ ID NOS: 146 147 are the nucleotide and amino acid sequences of the 232 amino acid isoform of VEGF-A IND 135 c SEQ ID NOS 148 149 are the nucleotide and amino acid sequences of fallotein O SEQ ID NOS 150 151 are the nucleotide and amino acid sequences D1701 VEGF Z SEQ ID NOS 152 153 are the nucleotide and amino acid sequences of clone 14-9 (VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO 153) SEQ ID NOS 154 155 are the nucleotide and amino acid sequences of clone 23-10 It (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO 155) SEQ BD NOS 156 157 are the nucleotide and amino acid sequences of clone 32-14 i (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO 157) N SEQ ID NOS 158 159 are the nucleotide and amino acid sequences of clone 52-15 O 10 (VEGF receptor binding domain= amino acids 1-105 of SEQ ID NO 159) SEQ ID SNOS 160 161 are the nucleotide and amino acid sequences of clone 53-3 (VEGF receptor binding domain= amino acids 1-103 of SEQ ID NO 161) SEQ ID NOS 162 163 are the nucleotide and amino acid sequences of clone 82-7 (VEGF receptor binding domain= amino acids 1-102 of SEQ ID NO 163) SEQ ID NOS 164 165 are the nucleotide and amino acid sequences of clone 82-9 (VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO 165) SEQ ID NOS 166 167 are the nucleotide and amino acid sequences of clone 82-11 (VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO 167) SEQ ID NOS 168 169 are.the nucleotide and amino acid sequences of clone 82-13 (VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO 169) SEQ ID NOS 170 171 are the nucleotide and amino acid sequences of clone 83-15 (VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO 171) SEQ ID NOS 172 173 are the nucleotide and amino acid sequences of clone 84-9 (VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO 173) SEQ ID NOS 174 175 are the nucleotide and amino acid sequences of clone 84-11 (VEGF receptor binding domain= amino acids 1-104 of SEQ ID NO 175) SEQ ID NOS: 176-1199 are indexed above in Example 1 in Table SEQ ID NO: 1200 is the sequence formula P-[PS]-C-V-X(3)-R-C-[GSTA]-G-C-C.
SEQ ID NO: 1201 is the sequence formula C-X(22-24)-P-[PSR]-C-V-X(3)-R-C- [GSTA]-G-C-C-X(6)-C-X(32-41 SEQ ID NO: 1202 is the sequence formula C-X(18-28)-P-X-C-X(4)-R-C-X-G-C(1-2)- X(6-12)-C-X(30-46)-C.
SEQ ID NO: 1203 is the sequence formula C-X(22-24)-P-[PSR]-C-V-X(3)-R-C-X-G- C-C-X(6)-C-X(32-41)-C.
SEQ ID NO: 1204 is the sequence formula TNTFxxxP.
SEQ ID NO: 1205 is the sequence EFGVATNTFFKPPCVSVYRCG.
SEQ ID NO: SEQ ID NO: SEQ ID NO: SEQ ID NO: SEQ ID NO: SEQ ID NO: SEQ ID NO: 1206 is the sequence TNTFFKPP.
1207 is the sequence formula TNTFFKPPCVxxxR.
1208 is the sequence formula TNTFFKPPCVxxxRCGGCC 1209 is a sequence of a VEGF region involved in VEGFR-I binding.
1210 is a sequence of a VEGF-C region involved in VEGFR-3 binding.
1211 is the sequence formula IEYIxxxS 1212 is the sequence formula TNTFXnP All publications and patents cited herein that are relevant to the description of the present invention are hereby incorporated by reference in their entirety.
While the present invention has been described in terms of specific embodiments, it is understood that variations and modifications will occur to those in the art. Accordingly, only such limitations as appear in the appended claims should be placed on the invention The entire disclosure in the complete specification of our Australian Patent Application No. 2001239884 is by this cross-reference incorporated into the present specification.
权利要求:
Claims (67)
[1] 1. A chimeric polypeptide comprising a plurality of peptide subunits derived fiom two or more naturally-occurring vertebrate vascular endothelial growth t factor polypeptides that have different vascular endothelial growth factor receptor binding profiles, Swherein the chimeric polypeptide binds at least one receptor of one of the IsN naturally-occurring vascular endothelial growth factor polypeptides, and 0 S 10 wherein the chimeric polypeptide has a different receptor binding profile than the naturally-occurring growth factor polypeptides.
[2] 2. A chimeric polypeptide according to claim 1, wherein the naturally-occurring growth factor polypeptides are selected fiom the group consisting of vascular endothelial growth factor A, vascular endothelial growth factor B, vascular endothelial growth factor C, vascular endothelial growth factor D, vascular endothelial growth factor E, platelet derived growth factor A, platelet derived growth factor B, and placenta growth factor.
[3] 3. A composition comprising a polypeptide according to claim 1 in a pharmaceutically acceptable carrier.
[4] 4. A polypeptide according to claim 1, wherein the polypeptide binds to human VEGFR-1 and human VEGFR-3 and fails to bind to human VEGFR-2. A polypeptide according to claim 1, wherein the polypeptide binds to human VEGFR-1, human VEGFR-2, and human VEGFR-3.
[5] 6. A polynucleotide comprising a nucleotide sequence encoding a polypeptide according to claim 1. -138- ^0 S7. An expression vector comprising a polynucleotide according to claim 6 operably linked to an expression control sequence. 0 z Z
[6] 8. A host cell comprising a polynucleotide according to claim 6 that expresses the chimeric polypeptide encoded thereby. S9. A polypeptide comprising an amino acid sequence of the formula: NH-I 2 -Xi-X 2 -X 3 -X 4 -X 5 -X 6 -X 7 -X-X 9 -COOH IND wherein X, comprises an amino acid sequence selected from the group S 10 consisting of amino acids 3-11 ofSEQ ID NO: 128 and amino acids 3-11 ofSEQ ID NO: 137; wherein X 2 comprises an amino acid sequence selected from the group consisting ofSEQ ID NOs: 129 and 138; wherein X 3 comprises an amino acid sequence selected from the group consisting ofSEQ ID NOs: 130 and 139; wherein X 4 comprises an amino acid sequence selected from the group consisting ofSEQ ID NOs: 131 and 140; wherein X 5 comprises an amino acid sequence selected from the group consisting ofSEQ ID NOs: 132 and 141; wherein X 6 comprises an amino acid sequence selected from the group consisting ofSEQ ID NOs: 133 and 142; wherein X 7 comprises an amino acid sequence selected from the group consisting ofSEQ ID NOs: 134 and 143; wherein X 8 comprises an amino acid sequence selected from the group consisting ofSEQ ID NOs: 135 and 144; wherein X, comprises an amino acid sequence selected from the group consisting ofSEQ ID NOs: 136 and 145; wherein NH 2 -XI-X 2 -X 3 -X 4 -X-X-X-XX 9 COOH is not identical to amino acids 34 to 135 ofSEQ ID NO: 2 or amino acids 112 to 216 ofSEQ ID NO: 22; and -139- O wherein the polypeptide binds to at least one receptor selected from the group consisting of human VEGFR-1, human VEGFR-2, and human VEGFR-3. 0
[7] 010. A polypeptide according to claim 9, wherein the polypeptide binds to exactly one receptor selected from the group consisting of human VEGFR-1, human It VEGFR-2, and human VEGFR-3.
[8] 11. A polypeptide according to claim 9, wherein the polypeptide further includes a signal peptide amino acid sequence connected to the amino acid O 10 sequence of the fonmula NH 2 -X,-X 2 -X 3 -X 4 7 -X 8 -Xg-COOH.
[9] 12. A polypeptide according to claim 9, wherein the polypeptide further includes an amino-terminal methionine residue.
[10] 13. A polypeptide according to claim 9, wherein the polypeptide further includes a tag amino acid sequence connected to the amino acid sequence of the formula NH,-X,-X 2 -X 3 -X 4 -X,-X 6 -X 7 -X 8 -X g -COOH.
[11] 14. A polypeptide according to claim 9, wherein the polypeptide further includes one or more amino acid sequences selected from the group consisting of a prepro-VEGF-C signal peptide, a prepro-VEGF-C amino-terminal propeptide, and a prepro-VEGF-C carboxy-terminal pro-peptide. A polypeptide comprising an amino acid sequence of the formula XN-V/PHD-Xc, wherein XN is selected from the group consisting of amino acids 1-34 of SEQ ID NO: 2, amino acids 1-111 of SEQ ID NO: 22, amino acids 1-34 of SEQ ID NO: 47, or fragments thereof; wherein V/PHD is a polypeptide according to claim 9; wherein Xc is selected from the group consisting of amino acids 136-191of SEQ ID NO: 2, amino acids 217-419 of SEQ ID NO: 22, amino acids 136-232, or fragments thereof; and -140- O wherein X, and Xc are identical to amino acid sequence in a naturally occurring human VEGF-A or VEGF-C precursor protein or a naturally occurring human VEGF-A z or VEGF-C isoform.
[12] 16. A composition comprising a polypeptide according to claim 9 in a Ir pharmaceutially acceptable carrier. C^ 17. A polynucleotide comprising an a nucleotide sequence encoding a I0 polypeptide according to claim 9. 0
[13] 18. A polynucleotide according to claim 17, comprising a nucleotide sequence of the formula: 3 -N 4 -N-N-Ng-N,-Ng-3' wherein N, comprises the VEGF nucleotide sequence of Al-F or Cl-F (SEQ ID NO: 3 or 23); wherein N, comprises the VEGF nucleotide sequence of A2-F or C2-F (SEQ ID NO: 4 or 24); wherein N 3 comprises the VEGF nucleotide sequence of A3-F or C3-F (SEQ ID NO: 5 or wherein N 4 comprises the VEGF nucleotide sequence of A4-F or C4-F (SEQ ID NO: 6 or 26); wherein N 5 comprises the VEGF nucleotide sequence of A5-F or (SEQ ID NO: 7 or 27); wherein N 6 comprises the VEGF nucleotide sequence of A6-F or C6-F (SEQ ID NO: 8 or 28); wherein N 7 comprises the VEGF nucleotide sequence of A7-F or C7-F (SEQ ID NO: 9 or 29); wherein Ng comprises the VEGF nucleotide sequence of A8-F or C8-F (SEQ ID NO: 10 or 30); and wherein N 9 comprises the VEGF nucleotide sequence of A9-F or C9-F (SEQ ID NO: 11 or 31). -141- IO
[14] 19. An expression vector comprising a nucleotide sequence according to claim 17. 0 A host cell transformed or expressed with a polynucleotide according to claim 17. In
[15] 21. A host cell according to claim 20 that expresses the polypeptide encoded by the polynucleotide. ON S 10 22. A method of modulating the growth of mammalian endothelial cells or mammalian endothelial precursor cells, comprising the step of contacting the cells with a polypeptide according to claim 1, in an amount effective to modulate the growth of mammalian endothelial cells.
[16] 23. A method of modulating the growth of mammalian hematopoietic progenitor cells, comprising the step of contacting the cells with a polypeptide according to claim 1, in an amount effective to modulate the growth of mammalian endothelial cells.
[17] 24. A method of treating a mammalian subject to modulate the growth of endothelial cells in said subject, comprising the step of administering to the marmnalian subject a polypeptide according to claim 1. A method according to claim 24, wherein the mammalian subject is a human.
[18] 26. A polypeptide comprising a non-naturally occurring vascular endothelial growth factor amino acid sequence, wherein said non-naturally occurring vascular endothelial growth factor amino acid sequence consists of an amino acid sequence that is at least 95% identical to an amino acid sequence of the formula: NH2-Xi-X 2 -X 3 -X 4 -X 5 -X 6 -X 7 -X 8 -X-COOH S-142- O wherein X, comprises an amino acid sequence selected from the group consisting of amino acids 3-11 of SEQ ID NO: 128 and amino acids 3-11 of SEQ ID NO: O z 137; 0wherein X 2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 129 and 138; tn wherein X 3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 130 and 139; eCc wherein X 4 comprises an amino acid sequence selected from the group N0 consisting of SEQ ID NOs: 131 and 140; O 10 wherein X 5 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 132 and 141; wherein X 6 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 133 and 142; wherein X7 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 134 and 143; wherein X, comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 135 and 144; wherein X, comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 136 and 145; and wherein the polypeptide binds to at least one receptor selected from the group consisting of human VEGFR-1, human VEGFR-2, and human VEGFR-3.
[19] 27. A method for making a polynucleotide that encodes a polypeptide that modulates the growth of mammalian endothelial cells, comprising the steps of: preparing polynucleotides that encode amino acid fragments of at least two vertebrate vascular endothelial growth factor polypeptides; commingling the polynucleotides under conditions wherein the polynucleotides recombine to form hybrid polynucleotides; expressing the hybrid polynucleotides to make hybrid polypeptides encoded by the hybrid polynucleotides; N -143- O 0 screening the hybrid polypeptides to identify a hybrid polypeptide that binds to a receptor for a vertebrate vascular endothelial growth factor; and 0 selecting the polynucleotide that encodes the hybrid polypeptide that binds to the receptor in the screening step.
[20] 28. A method according to claim 27, wherein said screening step comprises contacting the hybrid polypeptide to a cell that expresses the receptor, wherein C changes in cell growth or cell survival induced by the hybrid polypeptide is indicative of N0 binding between the hybrid polypeptide and the receptor.
[21] 29. A method according to claim 27 wherein the screening step comprises screening to identify a hybrid polypeptide that binds human VEGFR-1 and human VEGFR-3, and the selecting step comprises selecting a hybrid polypeptide that binds human VEGFR-1 and human VEGFR-3. A method according to claim 27 wherein the screening step comprises screening to identify a hybrid polypeptide that binds human VEGFR-1, VEGFR-2, and human VEGFR-3, and the selecting step comprises selecting a hybrid polypeptide that binds human VEGFR-1, VEGFR-2, and human VEGFR-3.
[22] 31. A method for making a polynucleotide that encodes a polypeptide that modulates the growth of mammalian endothelial cells, comprising the steps of: preparing a set of polynucleotide fragments having the following characteristics: the set includes a first subset of coding polynucleotide fragments, wherein each coding polynucleotide fragment of the first subset encodes at least four amino acids of the amino acid sequence of a first mammalian vascular endothelial growth factor; the set includes a second subset of coding polynucleotide fragments, wherein each coding polynucleotide fragment of the second subset encodes at least four amino acids of the amino acid sequence of a second mammalian vascular endothelial growth factor; -144- ID O commingling the polynucleotide fragments which comprise the set under conditions wherein the coding polynucleotide fragments from the first and second subsets O recombine to form hybrid polynucleotides; Sexpressing the hybrid polynucleotides to make hybrid polypeptides encoded by the hybrid polynucleotides; screening the hybrid polypeptides to identify a hybrid polypeptide that modulates the growth of mammalian endothelial cells; and selecting the polynucleotide that encodes the hybrid polypeptide that modulates the growth of mammalian endothelial cells in the screening step. S
[23] 32. A method according to claim 31, wherein the mammalian vascular endothelial growth factors comprise a receptor binding domain characterized by eight cysteines that are conserved in human Vascular Endothelial Growth Factor A (VEGF-A), human Vascular Endothelial Growth Factor B (VEGF-B), human Vascular Endothelial Growth Factor C (VEGF-C), and human Vascular Endothelial Growth Factor D (VEGF-D).
[24] 33. A method according to claim 31, wherein the first and second mammalian vascular endothelial growth factors are selected from the group consisting of VEGF-A VEGF-B, VEGF-C, VEGF-D, VEGF-E, PIGF, PDGF-a, and PDGF-P polypeptides.
[25] 34. A method according to claim 30, wherein the first and second mammalian vascular endothelial growth factors are human. A polypeptide comprising amino acids 1-102 as set forth in SEQ ID NO: 51.
[26] 36. A polypeptide comprising amino acids 1-102 as set forth in SEQ ID NO: 59. -145-
[27] 37. A polypeptide comprising amino acids 1-102 as set forth in SEQ ID NO: 63.
[28] 38. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 67.
[29] 39. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 71. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO:
[30] 41. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO:77.
[31] 42. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 153.
[32] 43. A polypeptide comprising amino acids 1-105 as set forth in SEQ ID NO: 155.
[33] 44. A polypeptide comprising amino acids 1-105 as set forth in SEQ ID NO: 157. A polypeptide comprising amino acids 1-105 as set forth in SEQ ID NO: 159.
[34] 46. A polypeptide comprising amino acids 1-103 as set forth in SEQ ID NO: 161. -146-
[35] 47. A polypeptide comprising amino acids 1-102 as set forth in SEQ ID NO: 163.
[36] 48. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 165.
[37] 49. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 167. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 169.
[38] 51. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 171.
[39] 52. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 173.
[40] 53. A polypeptide comprising amino acids 1-104 as set forth in SEQ ID NO: 175.
[41] 54. A polynucleotide comprising a nucleotide sequence encoding a polypeptide of any one of claims 35-53. A vector comprising a polynucleotide comprising a nucleotide sequence encoding a polypeptide of any one of claim 35-53.
[42] 56. A host cell comprising a polynucleotide comprising a nucleotide sequence encoding a polypeptide of any one of claim 35-53. -147- O
[43] 57. A polypeptide according to claim 9 or 26, wherein X 4 comprises SEQ ID NO: 140, and wherein the polypeptide binds to VEGFR-3. 0
[44] 58. A polypeptide according to claim 57, wherein X 5 comprises SEQ ID NO: 141. In
[45] 59. A polypeptide according to claim 57 or 58, wherein X, comprises e¢ SEQ ID NO: 144. O O 10 60. A molecule comprising the peptide sequence TNTFXnP, wherein X, comprises from one to seven amino acids, and wherein the molecule inhibits VEGF-C- mediated activation of VEGFR-3.
[46] 61. A molecule according to claim 60, wherein X, comprises three amino acids.
[47] 62. A molecule comprising the human VEGF-C peptide sequence EFGVATNTFFKPPCVSVYRCG or a fragment or variant thereof, wherein the molecule inhibits VEGF-C-mediated activation of VEGFR-3.
[48] 63. A molecule according to claim 62, wherein the molecule comprises the amino acid sequence EFGVATNTFFKPPCVSVYRCG
[49] 64. A molecule according to claim 63, wherein the molecule comprises the amino acid sequence TNTFFKPP. A molecule according to claim 62, wherein the fragment or variant comprises the amino acid sequence TNTFFKPPCVxxxR.
[50] 66. A molecule according to claim 62, wherein the fragment or variant comprises the amino acid sequence TNTFFKPPCVxxxRCGGCC. N -148- O S67. A polypeptide according to claim 9 or 26, wherein X 2 comprises SEQ ID NO: 129, and wherein the polypeptide binds to VEGFR-1. O
[51] 68. A polypeptide according to claim 67, wherein X 7 comprises SEQ ID NO: 134.
[52] 69. A polypeptide according to claim 67 or 68, wherein X 4 comprises SSEQ ID NO: 140, and wherein the polypeptide binds to VEGFR-3. IO O 10 70. A polypeptide according to claim 69, wherein X 5 comprises SEQ ID NO: 141.
[53] 71. A polypeptide according to claim 70, wherein X, comprises SEQ ID NO: 144.
[54] 72. A method for identifying a modulator of VEGFR-1 binding to VEGF-A comprising the steps of measuring binding between VEGFR-1 and VEGF-A in the presence and absence of a test compound under conditions that allow binding of VEGFR-1 to VEGF-A, and (ii) identifying as a modulator a test compound which alters VEGFR-1 binding to VEGF-A and which binds VEGF-A at a site defined by Phe 43 Met", Tyr 4 7 Gin 4 8 Tyr", Gln' 0 5 and Met 0 7 of SEQ ID NO: 2, or which binds VEGFR-1 at VEGFR-1 residues which interface with said residues of SEQ ID NO: 2.
[55] 73. A method for identifying a modulator of VEGFR-1 binding to VEGF-A comprising the steps of(i) measuring binding between VEGFR-1 and VEGF-A in the presence and absence of a test compound under conditions that allow binding of VEGFR-1 to VEGF-A, and (ii) identifying as a modulator a test compound which alters VEGFR-1 binding to VEGF-A and which binds VEGF-A at a site defined by Lys 4 2 Phe 43 Met44, Tyr 4 7 Gln 4 8 Tyr 51 1e 72 Lys 74 Asp 89 Gly 9 Leu 92 Gln' 05 Met' 07 Ile' 09 Phe"', His' 1 2 Gin' 1 5 le 11 7 Glu1 29 Arg 131 and Pro 1 32 of SEQ ID NO: 2, or which binds VEGFR-1 at VEGFR-1 residues which interface with said residues of SEQ ID NO: 2. -149- 0
[56] 74. A method for identifying a modulator of VEGFR-3 binding to VEGF-C comprising the steps of measuring binding between VEGFR-3 and VEGF-C z in the presence and absence of a test compound under conditions that allow binding of VEGFR-3 to VEGF-C, and (ii) identifying as a modulator a test compound which alters VEGFR-3 binding to VEGF-C and which binds VEGF-C at a site defined by Lys 20 tr Ser 2 1 Ile1 22 Trp 26 Arg 1 27 Gln 1 3 0 Phe'lS, Lys 5 i 3 Ser' 6 8 Gly 7 0 Leu 7 Tyr 1 84 Phe 86 Ile 9 0 Pro' 9 Pro' 1 6 Pro' 9 Arg 2 0 Met 1 2 and Ser2 3 of SEQ ID NO: 22, or which binds SVEGFR-3 at VEGFR-3 residues which interface with said residues of SEQ D NO: 22. IO O 10 75. A method for identifying a modulator of VEGFR-3 binding to VEGF-C comprising the steps of(i) measuring binding between VEGFR-3 and VEGF-C in the presence and absence of a test compound under conditions that allow binding of VEGFR-3 to VEGF-C, and (ii) identifying as a modulator a test compound which alters VEGFR-3 binding to VEGF-C and which binds VEGF-C at a site defined by Thr' 4 Asn' 4 9 Thr' 5 Phe 1 5 1 and Pro 1 5 of SEQ ID NO: 22, or which binds VEGFR-3 at VEGFR-3 residues which interface with said residues of SEQ ID NO: 22.
[57] 76. A pharmaceutical composition comprising a modulator identified by the method of claim 72 or 73.
[58] 77. A pharmaceutical composition comprising a modulator identified by the method of claim 74 or
[59] 78. Use of a modulator identified by the method of claim 72 or 73 in the production of a medicament to ameliorate pathologies arising from VEGFR-1 binding to a natural ligand that binds VEGFR-1.
[60] 79. Use of a modulator identified by the method of claim 74 or 75 in the production of a medicament to ameliorate pathologies arising from VEGFR-3 binding to a natural ligand that binds VEGFR-3. D -150- O A method for inhibiting VEGFR-1 binding to a natural ligand that binds VEGFR-1 comprising the step of contacting cells that express VEGFR-1 with a z pharmaceutical composition according to claim 76.
[61] 81. A method for inhibiting VEGFR-3 binding to a natural ligand that Ibinds VEGFR-3 comprising the step of contacting cells that express VEGFR-3 with a pharmaceutical composition according to claim 77. ND 82. A method to ameliorate a pathology arising from VEGFR-1 S 10 binding to a natural ligand that binds VEGFR-1 comprising the step of administering to an individual in need thereof a negative regulator of VEGFR-1 binding to the ligand in an amount effective to inhibit VEGFR-1 binding to the ligand, said negative regulator binding to an VEGFR-1 regulatory site selected from the group consisting of a site defined by Phe 43 Met 4 Tyr 47 Gin 48 Tyr 5 Gin 0 5 and Met' 0 7 of SEQ ID NO: 2 and a site defined by Lys 42 Phe 43 Met 44 Tyr 47 Gln 48 Tyr 1 Ile 72 Lys 74 Asp 8 9 Gly 9 Leu 92 Gin 05 Met 107 le' 09 Phe" 1 His" 2 Gin" 1 5 lie" 7 Glu 129 Arg 13 and Pro' 32 of SEQ ID NO: 2.
[62] 83. A method to ameliorate a pathology arising from VEGFR-3 binding to a natural ligand that binds VEGFR-3 comprising the step of administering to an individual in need thereof a negative regulator of VEGFR-3 binding to the ligand in an amount effective to inhibit VEGFR-3 binding to the ligand, said negative regulator binding to an VEGFR-3 regulatory site selected from the group consisting of a site defined by Ly 1 20 Ser 1 21 le 122 Trp' 26 Arg 1 27 Gin 1 30 Phes' 5 Lys 1 5 3 Ser 1 68 Gly 1 7 0 Leu' 7 Tyr 8 4 Phe 1 8 6 le' 90 Pro' 1 9 Pro 1 96 Pro 1 98 Arg 21 0 Met 21 2 and Ser 21 3 of SEQ ID NO: 22 and a site defined byThr' 4 8 Asn 1 4 9 Thr 1 50 Phe 1 51 and Pro 55 of SEQ ID NO: 22.
[63] 84. A pharmaceutical composition comprising a polypeptide according to any one of claims 1,2, 4-6, 9-15, 26, 35-53, 57-59, and 67-71.
[64] 85. A pharmaceutical composition comprising a molecule according to any one of claims 60-66. S-151- O
[65] 86. A method of treating a mammalian subject by administering a pharmaceutical composition according to claim 84 at a dosage effective to selectively Sstimulate VEGFR-1.
[66] 87. A method of treating a mammalian subject by administering a I pharmaceutical composition according to claim 84 at a dosage effective to selectively stimulate VEGFR-3. I 88. A method of treating a mammalian subject by administering a O 10 pharmaceutical composition according to claim 85 at a dosage effective to selectively stimulate VEGFR-1.
[67] 89. A method of treating a mammalian subject by administering a pharmaceutical composition according to claim 85 at a dosage effective to selectively stimulate VEGFR-3.
类似技术:
公开号 | 公开日 | 专利标题
AU2001239884B2|2006-08-10|Materials and methods involving hybrid vascular endothelial growth factor DNAs and proteins and screening methods for modulators
US7611711B2|2009-11-03|VEGFR-3 inhibitor materials and methods
JP4524340B2|2010-08-18|Vascular endothelial growth factor C | protein and its genes, variants, and uses thereof
US20040214766A1|2004-10-28|VEGF-C or VEGF-D materials and methods for treatment of neuropathologies
US6689580B1|2004-02-10|Growth factor
US20080057028A1|2008-03-06|Vegf-C or Vegf-D Materials and Methods for Stimulation of Neural Stem cells
WO2003004529A2|2003-01-16|Ephrin-tie receptor materials and methods
JP2004507208A5|2008-02-14|
ES2336731T3|2010-04-15|GROWTH FACTOR D DERIVED FROM PLATES, CODING DNA OF THE SAME AND ITS USES.
JP2003517275A|2003-05-27|Vascular endothelial cell growth factor-like protein from Orfvirus NZ2 that binds and activates mammalian VEGF receptor-2
Ortéga et al.1998|Control of vascular endothelial growth factor angiogenic activity by the extracellular matrix
JP2002525086A|2002-08-13|Platelet-derived growth factor C, DNA encoding the same, and use thereof
US20060269548A1|2006-11-30|Lymphatic endothelial cells materials and methods
JP2002535006A|2002-10-22|Platelet-derived growth factor / vascular endothelial growth factor-like growth factor H and its use
AU2008200559A1|2008-02-28|VEGFR-3 Binding peptides and their use for inhibiting angiogenesis
同族专利:
公开号 | 公开日
US6965010B2|2005-11-15|
AT377081T|2007-11-15|
US20050267024A1|2005-12-01|
DE60131146D1|2007-12-13|
US7309604B2|2007-12-18|
JP4981229B2|2012-07-18|
CA2400948A1|2001-08-30|
US20080058263A1|2008-03-06|
EP1259626B1|2007-10-31|
US7566566B2|2009-07-28|
AU3988401A|2001-09-03|
JP2004507208A|2004-03-11|
US7902149B2|2011-03-08|
DE60131146T2|2008-03-06|
US20110207664A1|2011-08-25|
US8278098B2|2012-10-02|
WO2001062942A2|2001-08-30|
US20090318352A1|2009-12-24|
AU2001239884B2|2006-08-10|
US20020151680A1|2002-10-17|
EP1259626A2|2002-11-27|
WO2001062942A3|2002-03-21|
AU2001239884C1|2001-09-03|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题
NL154598B|1970-11-10|1977-09-15|Organon Nv|PROCEDURE FOR DETERMINING AND DETERMINING LOW MOLECULAR COMPOUNDS AND PROTEINS THAT CAN SPECIFICALLY BIND THESE COMPOUNDS AND TEST PACKAGING.|
US3817837A|1971-05-14|1974-06-18|Syva Corp|Enzyme amplification assay|
US3939350A|1974-04-29|1976-02-17|Board Of Trustees Of The Leland Stanford Junior University|Fluorescent immunoassay employing total reflection for activation|
US3996345A|1974-08-12|1976-12-07|Syva Company|Fluorescence quenching with immunological pairs in immunoassays|
US4227427A|1977-09-08|1980-10-14|Dana Corporation|Drive unit assembly|
US4957939A|1981-07-24|1990-09-18|Schering Aktiengesellschaft|Sterile pharmaceutical compositions of gadolinium chelates useful enhancing NMR imaging|
US4472509A|1982-06-07|1984-09-18|Gansow Otto A|Metal chelate conjugated monoclonal antibodies|
US5498600A|1984-10-12|1996-03-12|Zymogenetics, Inc.|Biologically active mosaic proteins|
US5037630A|1985-01-14|1991-08-06|Neorx Corporation|Metal radionuclide labeled proteins for diagnosis and therapy|
US5139941A|1985-10-31|1992-08-18|University Of Florida Research Foundation, Inc.|AAV transduction vectors|
US4965392A|1987-03-26|1990-10-23|Neorx Corporation|Chelating compounds for metal-radionuclide labeled proteins|
US5087244A|1989-01-31|1992-02-11|C. R. Bard, Inc.|Catheter and method for locally applying medication to the wall of a blood vessel or other body lumen|
US5194596A|1989-07-27|1993-03-16|California Biotechnology Inc.|Production of vascular endothelial cell growth factor|
US5585362A|1989-08-22|1996-12-17|The Regents Of The University Of Michigan|Adenovirus vectors for gene therapy|
WO1991018088A1|1990-05-23|1991-11-28|The United States Of America, Represented By The Secretary, United States Department Of Commerce|Adeno-associated virus -based eucaryotic vectors|
US5328688A|1990-09-10|1994-07-12|Arch Development Corporation|Recombinant herpes simplex viruses vaccines and methods|
US5849571A|1990-10-10|1998-12-15|University Of Pittsburgh Of The Commonwealth System Of Higher Education|Latency active herpes virus promoters and their use|
US5674192A|1990-12-28|1997-10-07|Boston Scientific Corporation|Drug delivery|
US5252479A|1991-11-08|1993-10-12|Research Corporation Technologies, Inc.|Safe vector for gene therapy|
US5955291A|1992-01-09|1999-09-21|Alitalo; Kari|Antibodies recognizing tie receptor tyrosine kinase and uses thereof|
AT380243T|1992-03-13|2007-12-15|Biomerieux Bv|EPSTEIN-BARR-VIRUS RELATED PEPTIDES AND NUCLEIC ACID SEGMENTS|
DE69326631T2|1992-03-19|2000-06-08|Medtronic Inc|Intraluminal expansion device|
US5599352A|1992-03-19|1997-02-04|Medtronic, Inc.|Method of making a drug eluting stent|
US5879934A|1992-07-31|1999-03-09|University Of Pittsburgh Of The Commonwealth System Of Higher Education|Herpes simplex virus strains for gene transfer|
WO2000021560A1|1998-10-09|2000-04-20|Ludwig Institute For Cancer Research|Flt4 AS A TARGET FOR TUMOR IMAGING AND ANTI-TUMOR THERAPY|
WO1998033917A1|1994-11-14|1998-08-06|The Ludwig Institute For Cancer Research|Vascular endothelial growth factor c protein and gene, mutants thereof, and uses thereof|
US6107046A|1992-10-09|2000-08-22|Orion Corporation|Antibodies to Flt4, a receptor tyrosine kinase and uses thereof|
US5776755A|1992-10-09|1998-07-07|Helsinki University Licensing, Ltd.|FLT4, a receptor tyrosine kinase|
US6221839B1|1994-11-14|2001-04-24|Helsinki University Licensing Ltd. Oy|FIt4 ligand and methods of use|
US5336178A|1992-11-02|1994-08-09|Localmed, Inc.|Intravascular catheter with infusion array|
US5661033A|1992-11-25|1997-08-26|The Board Of Trustees Of The Leland Stanford Junior University|Gene transfer using herpes virus vectors as a tool for neuroprotection|
US5670488A|1992-12-03|1997-09-23|Genzyme Corporation|Adenovirus vector for gene therapy|
US5631237A|1992-12-22|1997-05-20|Dzau; Victor J.|Method for producing in vivo delivery of therapeutic agents via liposomes|
DE4311651A1|1993-04-08|1994-10-13|Boehringer Ingelheim Int|Virus for the transport of foreign DNA into higher eukaryotic cells|
US5464650A|1993-04-26|1995-11-07|Medtronic, Inc.|Intravascular stent and method|
US5834441A|1993-09-13|1998-11-10|Rhone-Poulenc Rorer Pharmaceuticals Inc.|Adeno-associated viral liposomes and methods related thereto|
DK0733103T3|1993-11-09|2004-07-12|Univ Johns Hopkins|Preparation of High Titers of Recombinant AAV Vectors|
FR2716682B1|1994-01-28|1996-04-26|Centre Nat Rech Scient|Process for the preparation of recombinant adeno-associated viruses and uses thereof.|
US6608182B1|1994-03-08|2003-08-19|Human Genome Sciences, Inc.|Human vascular endothelial growth factor 2|
US6734285B2|1994-03-08|2004-05-11|Human Genome Sciences, Inc.|Vascular endothelial growth factor 2 proteins and compositions|
JPH09510093A|1994-03-08|1997-10-14|ヒューマンジノームサイエンシーズ,インコーポレイテッド|Vascular endothelial growth factor 2|
US5932540A|1994-03-08|1999-08-03|Human Genome Sciences, Inc.|Vascular endothelial growth factor 2|
US6040157A|1994-03-08|2000-03-21|Human Genome Sciences, Inc.|Vascular endothelial growth factor 2|
US6204059B1|1994-06-30|2001-03-20|University Of Pittsburgh|AAV capsid vehicles for molecular transfer|
US5856152A|1994-10-28|1999-01-05|The Trustees Of The University Of Pennsylvania|Hybrid adenovirus-AAV vector and methods of use therefor|
US6245530B1|1995-08-01|2001-06-12|Ludwig Institute For Cancer Research|Receptor ligand|
US6361946B1|1997-02-05|2002-03-26|Licentia Ltd|Vascular endothelial growth factor C protein and gene, mutants thereof, and uses thereof|
US6645933B1|1995-08-01|2003-11-11|Helsinki University Licensing Ltd. Oy|Receptor ligand VEGF-C|
US6403088B1|1995-08-01|2002-06-11|Helsinki University Licensing, Ltd.|Antibodies reactive with VEGF-C, a ligand for the Flt4 receptor tyrosine kinase |
US5707385A|1994-11-16|1998-01-13|Advanced Cardiovascular Systems, Inc.|Drug loaded elastic membrane and method for delivery|
US5637113A|1994-12-13|1997-06-10|Advanced Cardiovascular Systems, Inc.|Polymer film for wrapping a stent structure|
US5792453A|1995-02-28|1998-08-11|The Regents Of The University Of California|Gene transfer-mediated angiogenesis therapy|
US5928939A|1995-03-01|1999-07-27|Ludwig Institute For Cancer Research|Vascular endothelial growth factor-b and dna coding therefor|
US5607918A|1995-03-01|1997-03-04|Ludwig Institute For Cancer Research|Vascular endothelial growth factor-B and DNA coding therefor|
US5707618A|1995-03-24|1998-01-13|Genzyme Corporation|Adenovirus vectors for gene therapy|
FR2732357B1|1995-03-31|1997-04-30|Rhone Poulenc Rorer Sa|VIRAL VECTORS AND USE FOR THE TREATMENT OF HYPERPROLIFERATIVE DISORDERS, ESPECIALLY RESTENOSIS|
US5773289A|1995-06-06|1998-06-30|University Of Pittsburgh|AAV directed targeted integration|
US5622856A|1995-08-03|1997-04-22|Avigen|High efficiency helper system for AAV vector production|
DK0848755T4|1995-09-08|2011-05-23|Genentech Inc|VEGF related protein|
JP4086315B2|1995-09-29|2008-05-14|ユニベルシタデグリスチュディディシエナ|Regulatory genes and uses thereof|
US5653689A|1995-09-30|1997-08-05|Abacus Design & Development, Inc.|Infusion catheter|
US5830727A|1995-11-18|1998-11-03|Human Gene Therapy Research Institute|Herpes simplex virus amplicon mini-vector gene transfer system|
US6100071A|1996-05-07|2000-08-08|Genentech, Inc.|Receptors as novel inhibitors of vascular endothelial growth factor activity and processes for their production|
US5785965A|1996-05-15|1998-07-28|The Board Of Trustees Of The Leland Stanford Junior Univ.|VEGF gene transfer into endothelial cells for vascular prosthesis|
ES2242227T5|1996-07-15|2011-12-09|Chugai Seiyaku Kabushiki Kaisha|NEW VEGF TYPE FACTOR.|
ES2251740T3|1996-08-23|2006-05-01|Ludwig Institute For Cancer Research|GROWTH FACTOR OF VASCULAR D RECOMBINANT ENDOTHELIAL CELLS .|
EP1488761A1|1996-11-01|2004-12-22|Ark Therapeutics Limited|Device for delivering a therapeutic agent to a blood vessel|
CA2277519A1|1997-01-10|1998-07-16|Massachusetts Institute Of Technology|Treatments for neurotoxicity in alzheimer's disease by .beta.-amyloid peptides|
US6130071A|1997-02-05|2000-10-10|Helsinki University Licensing, Ltd.|Vascular endothelial growth factor C ΔCys156 protein and gene, and uses thereof|
EP1037994A1|1997-12-09|2000-09-27|Children's Medical Center Corporation|Peptide antagonists of vascular endothelial growth factor|
DE69839529D1|1997-12-24|2008-07-03|Ludwig Inst Cancer Res|EXPRESSION VECTORS AND CELL LINES FOR EXPRESSING VASCULAR GROWTH FACTOR D, AND METHOD FOR TREATING MELANOMA|
EP1126870B1|1998-10-26|2004-09-08|Ludwig Institute For Cancer Research|Use of vegf-c or vegf-d gene or protein to prevent restenosis|
EP1126863B1|1998-11-02|2006-05-03|Ludwig Institute For Cancer Research|Vascular endothelial growth factor-like protein from orf virus nz10 binds and activates mammalian vegf receptor-2|
JP4632543B2|1998-12-21|2011-02-23|ルードヴィッヒインスティテュートフォーキャンサーリサーチ|Cleaved VEGF-D antibody and use thereof|
KR20010101981A|1999-02-08|2001-11-15|벤슨 로버트 에이치.|Vascular endothelial growth factor-2|
WO2001012669A1|1999-08-16|2001-02-22|Universita' Degli Studi Di Siena|Vegf-d and angiogenic use thereof|
US20030211988A1|2001-01-09|2003-11-13|Epstein Stephen E|Enhancing lymph channel development and treatment of lymphatic obstructive disease|
AT377081T|2000-02-25|2007-11-15|Ludwig Inst Cancer Res|MATERIALS AND METHODS CONTAINING HYBRID VASCULAR ENDOTHELIC GROWTH FACTORS DNA AND PROTEINS AND SCREENING METHOD FOR MODULATORS|
US6689352B2|2000-05-03|2004-02-10|Ludwig Institute For Cancer Research|Method for activating only the vascular endothelial growth factor receptor-3 and uses thereof|
US20050032697A1|2003-06-12|2005-02-10|Kari Alitalo|Heparin binding VEGFR-3 ligands|
ES2363758T3|2005-08-15|2011-08-16|Vegenics Pty Ltd|MODIFIED VEGF AND PDGF WITH IMPROVED ANGIOGENIC PROPERTIES.|WO2002060950A2|1994-11-14|2002-08-08|Ludwig Institute For Cancer Research|Flt4 as a target for tumor imaging and anti-tumor therapy|
AU5026100A|1999-05-20|2000-12-12|Scios Inc.|Vascular endothelial growth factor dimers|
US7167615B1|1999-11-05|2007-01-23|Board Of Regents, The University Of Texas System|Resonant waveguide-grating filters and sensors and methods for making and using same|
AT377081T|2000-02-25|2007-11-15|Ludwig Inst Cancer Res|MATERIALS AND METHODS CONTAINING HYBRID VASCULAR ENDOTHELIC GROWTH FACTORS DNA AND PROTEINS AND SCREENING METHOD FOR MODULATORS|
US8263739B2|2000-06-02|2012-09-11|Bracco Suisse Sa|Compounds for targeting endothelial cells, compositions containing the same and methods for their use|
EP2279757A3|2000-06-02|2011-08-03|Bracco Suisse SA|Compounds for targeting endothelial cells|
US7405278B2|2000-08-10|2008-07-29|Masabumi Shibuya|Chimeric human-type vascular endothelial cell growth factor|
US20040132675A1|2002-02-08|2004-07-08|Calvin Kuo|Method for treating cancer and increasing hematocrit levels|
EP2135879A3|2002-06-28|2010-06-23|Domantis Limited|Ligand|
AT477280T|2001-06-28|2010-08-15|Domantis Ltd|DOUBLE-SPECIFIC LIGAND AND ITS USE|
US7696320B2|2004-08-24|2010-04-13|Domantis Limited|Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor|
US9321832B2|2002-06-28|2016-04-26|Domantis Limited|Ligand|
US20050032697A1|2003-06-12|2005-02-10|Kari Alitalo|Heparin binding VEGFR-3 ligands|
US8623822B2|2002-03-01|2014-01-07|Bracco Suisse Sa|KDR and VEGF/KDR binding peptides and their use in diagnosis and therapy|
US7261876B2|2002-03-01|2007-08-28|Bracco International Bv|Multivalent constructs for therapeutic and diagnostic applications|
US7794693B2|2002-03-01|2010-09-14|Bracco International B.V.|Targeting vector-phospholipid conjugates|
US20050100963A1|2002-03-01|2005-05-12|Dyax Corporation|KDR and VEGF/KDR binding peptides and their use in diagnosis and therapy|
CA2494542A1|2002-05-03|2003-11-13|Ludwig Institute For Cancer Research|Preventing secondary lymphedema with vegf-d dna|
WO2004058821A2|2002-12-27|2004-07-15|Domantis Limited|Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand|
US9453251B2|2002-10-08|2016-09-27|Pfenex Inc.|Expression of mammalian proteins in Pseudomonas fluorescens |
ES2692166T3|2003-03-03|2018-11-30|Dyax Corp.|Peptides that specifically bind to the HGF receptorand uses thereof|
WO2005011722A2|2003-06-12|2005-02-10|Ludwig Institute For Cancer Research|Use of vegf-c or vegf-d in reconstructive surgery|
AU2005222384A1|2004-03-05|2005-09-22|Vegenics Limited|Growth factor binding constructs materials and methods|
EP1773373A4|2004-03-08|2010-11-17|Ludwig Inst Cancer Res|Method for modulating, regulating and/or stabilizing angiogenesis|
WO2006014899A2|2004-07-26|2006-02-09|Dow Global Technologies Inc.|Process for improved protein expression by strain engineering|
US7553496B2|2004-12-21|2009-06-30|University Of Kentucky Research Foundation|VEGF-A as an inhibitor of angiogenesis and methods of using same|
MX2007012766A|2005-04-12|2008-10-01|Intradigm Corp|Composition and methods of rnai therapeutics for treatment of cancer and other neovascularization diseases.|
US7893244B2|2005-04-12|2011-02-22|Intradigm Corporation|Composition and methods of RNAi therapeutics for treatment of cancer and other neovascularization diseases|
ES2363758T3|2005-08-15|2011-08-16|Vegenics Pty Ltd|MODIFIED VEGF AND PDGF WITH IMPROVED ANGIOGENIC PROPERTIES.|
KR20080077238A|2005-12-01|2008-08-21|도만티스 리미티드|Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1|
US20090214496A1|2006-01-30|2009-08-27|Licentia Ltd.|Bmx/etk tyrosine kinase gene therapy materials and methods|
CN1903880B|2006-08-02|2010-05-12|中国人民解放军军事医学科学院基础医学研究所|Antitumour vascular endothelial growth factor VEGF-E antigen, its coding gene and application|
WO2008096268A2|2007-02-07|2008-08-14|Vegenics Limited|Autologous lymph node transfer in combination with vegf-c or vegf-d growth factor therapy to treat secondary lymphedema and to improve reconstructive surgery|
US9580719B2|2007-04-27|2017-02-28|Pfenex, Inc.|Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins|
MX2009011523A|2007-04-27|2009-11-09|Dow Global Technologies Inc|Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins.|
CA2683801A1|2007-06-06|2008-12-11|Domantis Limited|Polypeptides, antibody variable domains and antagonists|
WO2010065995A1|2008-12-08|2010-06-17|Vegenics Limited|Isolated vegf-c and vegf-d peptides and uses thereof|
WO2011154308A1|2010-06-08|2011-12-15|Proyecto De Biomedicina Cima, S.L.|New compositions and cell therapy methods for the treatment of cirrhosis|
WO2012088563A1|2010-11-24|2012-07-05|Vegenics Pty Limited|Vegfr-2-specific forms of vegf-d and vegf-c and uses thereof|
US9511097B2|2012-11-20|2016-12-06|Albert Einstein College Of Medicine, Inc.|Regeneration of coronary artery by coronary endothelial specific progenitor cells|
RS60026B1|2013-02-18|2020-04-30|Vegenics Pty Ltd|Ligand binding molecules and uses thereof|
TW201506036A|2013-08-14|2015-02-16|Laurantis Pharma Oy|Therapeutic use of VEGF-C and CCBE1|
US20180111972A1|2015-01-16|2018-04-26|The Board Of Trustees Of The Leland Stanford Junior University|Hybrid chimera polypeptides as dual inhibitors of vascular endothelial growth factor receptor and platelet-derived growth factor receptor|
US11180535B1|2016-12-07|2021-11-23|David Gordon Bermudes|Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria|
法律状态:
2009-09-24| MK4| Application lapsed section 142(2)(d) - no continuation fee paid for the application|
优先权:
申请号 | 申请日 | 专利标题
US18520500P| true| 2000-02-25|2000-02-25||
US60/185,205||2000-02-25||
US20533100P| true| 2000-05-18|2000-05-18||
US60/205,331||2000-05-18||
PCT/US2001/006113|WO2001062942A2|2000-02-25|2001-02-26|MATERIALS AND METHODS INVOLVING HYBRID VASCULAR ENDOTHELIAL GROWTH FACTOR DNAs AND PROTEINS AND SCREENING METHODS FOR MODULATORS|
[返回顶部]